DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and NEURL1

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_011538633.1 Gene:NEURL1 / 9148 HGNCID:7761 Length:612 Species:Homo sapiens


Alignment Length:279 Identity:69/279 - (24%)
Similarity:108/279 - (38%) Gaps:86/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PIGSLECAPTLSSRKRQLSRFHPY-HGSNIQLGDDATVAYRRASFADALTFSERPLAPGDIFLVE 108
            |.|.|...|.|         |||: .||.|.:........|:|||.:|:|||.||:...:...::
Human    92 PSGGLPATPLL---------FHPHTKGSQILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLK 147

  Fly   109 IEKIERGWSGHMRLGLTELAPNVIRTSSEGLPHFALPDLANLGNSWIYPISKFEMNQRQDANDII 173
            |.|.:..|||.:|||.|...|:  |...:.||.:|.|||.:....|...:.:...|:    .:||
Human   148 ITKKQCCWSGALRLGFTSKDPS--RIHPDSLPKYACPDLVSQSGFWAKALPEEFANE----GNII 206

  Fly   174 EPETDDAPHRNLLGDATHVRTPRGLLPKRLLRPAMGNGNDSDILLTDKGSRIGIIYVPTVQSDSK 238
            ....|                .:|.:..|:        |||.::|...|.|              
Human   207 AFWVD----------------KKGRVFHRI--------NDSAVMLFFSGVR-------------- 233

  Fly   239 GELHFIINGVDRGPVSRDIPLNRAPLFVVIDVYGTTKQIRIIQLEGIL--SLQ----SACRNVIL 297
                                 ...||:.::||||.|:.::::..|.:|  .|:    :|.|...|
Human   234 ---------------------TADPLWALVDVYGLTRGVQLLDSELVLPDCLRPRSFTALRRPSL 277

  Fly   298 ESFAEDA-----ISELPLP 311
            ...|:||     :.:|.:|
Human   278 RREADDARLSVSLCDLNVP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 53/216 (25%)
SOCS_SOCS_like 283..321 CDD:239687 11/40 (28%)
NEURL1XP_011538633.1 NEUZ 99..221 CDD:128856 42/160 (26%)
SPRY 103..251 CDD:295394 53/212 (25%)
Neuralized 103..168 CDD:284568 25/64 (39%)
NEUZ 330..452 CDD:128856
SPRY 333..484 CDD:295394
Neuralized 334..400 CDD:284568
zf-C3HC4_3 556..605 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.