DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and NEURL4

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_115818.2 Gene:NEURL4 / 84461 HGNCID:34410 Length:1562 Species:Homo sapiens


Alignment Length:221 Identity:61/221 - (27%)
Similarity:98/221 - (44%) Gaps:55/221 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RFHPYHGSNIQLGDDATVAYRRASFADALTFSERPLAPGDIFLVEIEKIERGWSGHMRLGLTELA 128
            |||...|.|:.|.:|.|.|.|.|.:|..|.||.:.|...::|.|::|:::..|:|.:|||||.||
Human   915 RFHSTCGKNVTLEEDGTRAVRAAGYAHGLVFSTKELRAEEVFEVKVEELDEKWAGSLRLGLTTLA 979

  Fly   129 PNVIRTSS----EGLPHFALPDLANLGNSWIYPISKFEMNQRQDANDIIEPETDDAPHRNLLGDA 189
            |..:...:    .|||    |.|..|.....:.:|..|:  |:|                     
Human   980 PGEMGPGAGGGGPGLP----PSLPELRTKTTWMVSSCEV--RRD--------------------- 1017

  Fly   190 THVRTPRGLLPKRLLRPAMGNGNDSDILLTDKGSRIGIIYVPTVQSDSKGELHFIINGVDRGPVS 254
                   |.|.:      |..|.:.:.|  ..|||:|      |:..:...:|.:::|.|.||.:
Human  1018 -------GQLQR------MNYGRNLERL--GVGSRVG------VRRGADDTMHILVDGEDMGPAA 1061

  Fly   255 RDIPLNRAPLFVVIDVYGTTKQIRII 280
            ..|..|   ::.|:|:||..:.:.|:
Human  1062 TGIAKN---VWAVLDLYGPVRGVSIV 1084

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 60/219 (27%)
SOCS_SOCS_like 283..321 CDD:239687
NEURL4NP_115818.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
SPRY_NHR_like 43..205 CDD:293945
NEUZ 45..163 CDD:128856
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..236
NEUZ 316..437 CDD:128856
SPRY_NHR_like 320..482 CDD:293945
NEUZ 520..642 CDD:128856
SPRY_NHR_like 523..684 CDD:293945
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 691..716
NEUZ 716..838 CDD:128856
SPRY_NHR_like 718..882 CDD:293945
SPRY_NHR_like 915..1084 CDD:293945 60/219 (27%)
NEUZ 915..1042 CDD:128856 49/174 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1086..1123
NEUZ 1132..1247 CDD:128856
SPRY_NHR_like 1133..1292 CDD:293945
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491552at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.