DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and neurl1aa

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_021330967.1 Gene:neurl1aa / 561943 ZFINID:ZDB-GENE-090311-3 Length:572 Species:Danio rerio


Alignment Length:221 Identity:57/221 - (25%)
Similarity:88/221 - (39%) Gaps:68/221 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FHP-YHGSNIQLGDDATVAYRRASFADALTFSERPLAPGDIFLVEIEKIERGWSGHMRLGLTELA 128
            ||| ..||.|.:........|:|||.:|:|||.||:|..:...::|.|.:..|||.:|||.|...
Zfish    62 FHPNAKGSQIVMDLAQRSVKRQASFCNAITFSNRPIALYEQVRLKITKKQCCWSGALRLGFTSKD 126

  Fly   129 PNVIRTSSEGLPHFALPDLANLGNSWIYPISKFEMNQRQDANDIIEPETDDAPHRNLLGDATHVR 193
            |:  |.:.:.||.:|.|||.:....|...:                || :.|...||:.      
Zfish   127 PS--RINPDSLPKYACPDLVSQSGFWAKAL----------------PE-EFANEGNLIS------ 166

  Fly   194 TPRGLLPKRLLRPAMGNGNDSDILLTDKGSRIGIIYVPTVQSDSKGELHFIINGVDRGPVSRDIP 258
                                              .:|     |.||.:.:.||  |..|:.....
Zfish   167 ----------------------------------FWV-----DKKGRVFYRIN--DSSPMLFFSG 190

  Fly   259 LNRA-PLFVVIDVYGTTKQIRIIQLE 283
            :... ||:.:|||||.|:.:::::.|
Zfish   191 VRTTEPLWALIDVYGLTRGVQLLESE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 56/216 (26%)
SOCS_SOCS_like 283..321 CDD:239687 1/1 (100%)
neurl1aaXP_021330967.1 NEUZ 59..180 CDD:128856 44/181 (24%)
Neuralized 296..446 CDD:311244
mRING-HC-C3HC5_NEU1A 517..560 CDD:319699
modified RING-HC finger (C3HC5-type) 519..558 CDD:319699
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.