DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and neurl2

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001077300.1 Gene:neurl2 / 560768 ZFINID:ZDB-GENE-070410-31 Length:275 Species:Danio rerio


Alignment Length:283 Identity:106/283 - (37%)
Similarity:151/283 - (53%) Gaps:44/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 QLSRFHPYHGSNIQLGDDATVAYRRASFADALTFSERPLAPGDIFLVEIEKIERGWSGHMRLGLT 125
            |...||..||:|:||....|.|.|..|||:.:.||:.||:||:|||||||:.|.||.||:|:|||
Zfish     7 QFMEFHSVHGTNVQLDPSRTRATRVESFANGVCFSKDPLSPGEIFLVEIEEKELGWCGHLRIGLT 71

  Fly   126 ELAPNVIRTSSEGLPHFALPDLANLGNSWIYPISK----------FEMNQRQDANDIIEPETDDA 180
            ...|..:.|    :|.::||||...|:||::.|::          .|:.|..:.||     |.:.
Zfish    72 AHDPRTLDT----VPEYSLPDLVEKGDSWVFAITRNHNKVTEDEGAEVEQPNEGND-----TSNK 127

  Fly   181 PHRNLLGDATHVRTPRGLLPKRLLRPAMGNGNDSDIL----------LTDKGSRIGIIYVPTVQS 235
            | :....| ||:......:|:..|......|..|.||          .|.:.||||::|||    
Zfish   128 P-KTFFTD-THLYIENMGIPRDKLVGRSRPGRFSHILDDLYKTNALPPTARRSRIGVVYVP---- 186

  Fly   236 DSKGE----LHFIINGVDRGPVSRDIPLNRAPLFVVIDVYGTTKQIRIIQLE-GILSLQSACRNV 295
              |||    :|.:|||.|.|..::.||.|: ||:.|:||:..||.:||:|:| |..|||:.||..
Zfish   187 --KGEGCANMHIVINGEDMGASAKRIPTNK-PLYAVVDVFAATKCVRIVQVEYGFASLQTLCRKT 248

  Fly   296 ILESFAED-AISELPLPESIKRF 317
            |.:..... |:..|.|||.:|.:
Zfish   249 IQKHIVHRMALDWLELPELLKHY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 89/239 (37%)
SOCS_SOCS_like 283..321 CDD:239687 14/37 (38%)
neurl2NP_001077300.1 SPRY_NHR_like 10..232 CDD:293945 89/239 (37%)
SOCS_box 240..275 CDD:198037 12/32 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4820
eggNOG 1 0.900 - - E1_KOG4625
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15435
Inparanoid 1 1.050 158 1.000 Inparanoid score I4241
OMA 1 1.010 - - QHG48960
OrthoDB 1 1.010 - - D1185754at2759
OrthoFinder 1 1.000 - - FOG0008119
OrthoInspector 1 1.000 - - oto40075
orthoMCL 1 0.900 - - OOG6_108559
Panther 1 1.100 - - LDO PTHR12429
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6069
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.