DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and neurl4

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_021335985.1 Gene:neurl4 / 555331 ZFINID:ZDB-GENE-100318-4 Length:1588 Species:Danio rerio


Alignment Length:305 Identity:78/305 - (25%)
Similarity:121/305 - (39%) Gaps:76/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PAALCAP----------SRAAYAAAEQEDPDPDQEQDRGRESPI----GSLECAPTLSSRKRQLS 63
            |||...|          .:||.|....:..|.....|...|.|.    || .|:.:.::....| 
Zfish   689 PAAWNVPPNVYAVVDLYGQAAQATIMDDMADLPPLPDDSSEGPTAMSPGS-PCSISGATAANDL- 751

  Fly    64 RFHPYHGSNIQLGDDATVAYR---RASFADALTFSERPLAPGDIFLVEIEKIERGWSGHMRLGLT 125
            |||..||:|..:.:....|.|   |:.|.||:..|.|.|..|::|.:.|:|:...|||.:..|:|
Zfish   752 RFHQLHGTNAVITNGGRTALRQNCRSEFNDAIVISNRCLREGELFEIVIQKMVDRWSGSIEAGVT 816

  Fly   126 ELAPNVIRTSSEGLPHFALPDLANLGNSWIYPISKFEMNQRQDANDIIEPETDDAPHRNLLGDAT 190
            .:.|..:.     .|: .:.|:..  ::|:...:..    .||.|.:          ||      
Zfish   817 AIRPEELE-----FPN-TMTDIDY--DTWMLSGTAI----MQDGNTM----------RN------ 853

  Fly   191 HVRTPRGLLPKRLLRPAMGNGNDSDILLTDKGSRIGIIYVPTVQSDSKGELHFIINGVDRGPVSR 255
                              ..|.|.|.|.|  .||||::...|      |:||:.|||:|:|....
Zfish   854 ------------------NYGCDLDSLTT--ASRIGMMRTAT------GDLHYFINGLDQGVACT 892

  Fly   256 DIPLNRAPLFVVIDVYGTTKQIRIIQLEGILSLQSACRNVILESF 300
            .:|   :.::.|:|:||...|:.|....|.|.......|:..:||
Zfish   893 GLP---SEVYAVVDLYGQCVQVSITSSSGPLDNSLCTSNITEKSF 934

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 57/218 (26%)
SOCS_SOCS_like 283..321 CDD:239687 5/18 (28%)
neurl4XP_021335985.1 SPRY_NHR_like 4..166 CDD:293945
SPRY_NHR_like 347..509 CDD:293945
SPRY_NHR_like 553..713 CDD:293945 7/23 (30%)
SPRY_NHR_like 752..914 CDD:293945 57/218 (26%)
SPRY_NHR_like 946..1112 CDD:293945
SPRY_NHR_like 1158..1317 CDD:293945
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491552at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.