DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and Neurl3

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001014122.1 Gene:Neurl3 / 316326 RGDID:1359633 Length:254 Species:Rattus norvegicus


Alignment Length:255 Identity:62/255 - (24%)
Similarity:95/255 - (37%) Gaps:81/255 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RQLSRFH-PYHGSNIQLGDDATVAYRRASFADALTFSERPLAPGDIFLVEIEKIERGWSGHMRLG 123
            |:...|| ...|:.:.|.|..:.|.||::|.|.:.||:||:.||:...:.:.:.|.||.|.:|:|
  Rat    15 REALSFHGDATGAQVHLDDQRSTARRRSTFHDGIVFSQRPVWPGERVALRVLRHEDGWCGGLRVG 79

  Fly   124 LTELAPNVIRTSSEGLPHFALPDLANLGNSWIYPISKFEMNQRQDANDIIEPETDDAPHRNLLGD 188
            .|.|.|..:..|.  ||.|..|||.....:|                                  
  Rat    80 FTRLDPAQVAASC--LPPFVCPDLEEQSPTW---------------------------------- 108

  Fly   189 ATHVRTPRGLLPKRLLRPAMGNGNDSDILLTDKGSRIGIIYVPTVQSDSKGELHFIINGVDRGPV 253
                   ..|||:..:|.    ||                 |.....:.:|.|...:|......:
  Rat   109 -------AALLPEGFVRA----GN-----------------VVCFWVNRRGWLFAKVNAGRPLLL 145

  Fly   254 SRDIPLNRAPLFVVIDVYGTTKQIRIIQLEGILSLQSACRNVILESFAEDAISELPLPES 313
            .:|:.:..|||:.|:|||||||.|.::..:....:.|.                .|:|||
  Rat   146 RKDVLVQGAPLWAVMDVYGTTKAIELLDPKANAWITSG----------------EPMPES 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 56/216 (26%)
SOCS_SOCS_like 283..321 CDD:239687 5/31 (16%)
Neurl3NP_001014122.1 Neuralized 20..173 CDD:399869 56/216 (26%)
RING-HC_NEURL3 195..236 CDD:319466
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.