DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and Neurl1

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_006231572.1 Gene:Neurl1 / 309459 RGDID:1307021 Length:574 Species:Rattus norvegicus


Alignment Length:288 Identity:68/288 - (23%)
Similarity:103/288 - (35%) Gaps:101/288 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PSRAAYAAAEQEDPDPDQEQDR-GRESPIGS-------LECAPTLSSRKRQLS--RFHPY-HGSN 72
            ||||:..       .|...:|. |...|:.|       ..|.|.||......:  .|||: .||.
  Rat    16 PSRASRG-------HPQNLKDSIGSSFPVPSHRCHHKQKHCPPALSGGGLPATPLLFHPHTKGSQ 73

  Fly    73 IQLGDDATVAYRRASFADALTFSERPLAPGDIFLVEIEKIERGWSGHMRLGLTELAPNVIRTSSE 137
            |.:........|:|||.:|:|||.||:...:...::|.|.:..|||.:|||.|...|:  |...:
  Rat    74 ILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLKITKKQCCWSGALRLGFTSKDPS--RIHPD 136

  Fly   138 GLPHFALPDLANLGNSWIYPISKFEMNQRQDANDIIEPETDDAPHRNLLGDATHVRTPRGLLPKR 202
            .||.:|.|||.:....|                                         ...||:.
  Rat   137 SLPKYACPDLVSQSGFW-----------------------------------------AKALPEE 160

  Fly   203 LLRPAMGNGNDSDILLTDKGSRIGIIYVPTVQSDSKGELHFIIN---------GVDRGPVSRDIP 258
            .       .|:.:|:         ..:|     |.||.:.:.||         ||....      
  Rat   161 F-------ANEGNII---------AFWV-----DKKGRVFYRINESAAMLFFSGVRTAD------ 198

  Fly   259 LNRAPLFVVIDVYGTTKQIRIIQLEGIL 286
                ||:.::||||.|:.::::..|.:|
  Rat   199 ----PLWALVDVYGLTRGVQLLDSELVL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 53/225 (24%)
SOCS_SOCS_like 283..321 CDD:239687 2/4 (50%)
Neurl1XP_006231572.1 NEUZ 61..183 CDD:128856 42/185 (23%)
SPRY 65..213 CDD:295394 53/221 (24%)
Neuralized 65..130 CDD:284568 25/64 (39%)
NEUZ 292..414 CDD:128856
SPRY 295..446 CDD:295394
Neuralized 296..362 CDD:284568
zf-C3HC4_3 518..567 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.