DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and Neurl1b

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001075125.1 Gene:Neurl1b / 240055 MGIID:3643092 Length:546 Species:Mus musculus


Alignment Length:309 Identity:71/309 - (22%)
Similarity:113/309 - (36%) Gaps:111/309 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LDEAAAPAALCAPSRAAYAAAEQEDPDPDQEQDRGRESPIGSLECAPTLSSRKRQLSRFHPY-HG 70
            |.:::.||.|.| :|..|.      |.|::....| |:|                  |||.. .|
Mouse     9 LPDSSPPARLLA-TRPCYG------PGPERRAVLG-EAP------------------RFHAQAKG 47

  Fly    71 SNIQLGDDATVAYRRASFADALTFSERPLAPGDIFLVEIEKIERGWSGHMRLGLTELAPNVIRTS 135
            .|::|...:..|.||.||.:.:||::||:...:...:.:..:..||||.:|.|.|...|:::  |
Mouse    48 KNVRLDGHSRRATRRNSFCNGVTFTQRPIRLYEQVRLRLVAVRPGWSGALRFGFTAHDPSLM--S 110

  Fly   136 SEGLPHFALPDLANLGNSWIYPISKFEMNQRQDANDIIEPETDDAPHRNLLGDATHVRTPRGLLP 200
            ::.:|.:|.|||......|                                         ...||
Mouse   111 AQDIPKYACPDLVTRPGYW-----------------------------------------AKALP 134

  Fly   201 KRL-LRPAMGNGNDSDILLTDKGSRIGIIYVPTVQSDSKGELHFIINGVDRGPVSRDIPLNRAPL 264
            :.| ||         |.:|.....|.|.::    .|.:.||......||..|          .||
Mouse   135 ENLALR---------DTVLAYWADRHGRVF----YSVNDGEPVLFHCGVAVG----------GPL 176

  Fly   265 FVVIDVYGTTKQIRIIQLEGILSLQSACRNVILESFAEDAISELPLPES 313
            :.:|||||.|.:::                 :|||...|.::.|.|.::
Mouse   177 WALIDVYGITDEVQ-----------------LLESTFADTLTPLRLGQA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 53/217 (24%)
SOCS_SOCS_like 283..321 CDD:239687 6/31 (19%)
Neurl1bNP_001075125.1 SPRY 40..189 CDD:295394 53/214 (25%)
NEUZ 40..159 CDD:128856 40/174 (23%)
Neuralized 41..106 CDD:284568 21/64 (33%)
NEUZ 271..390 CDD:128856
Neuralized 273..338 CDD:284568
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 429..490
zf-C3HC4_3 490..540 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.