DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and Neurl3

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_006495909.1 Gene:Neurl3 / 214854 MGIID:2429944 Length:268 Species:Mus musculus


Alignment Length:277 Identity:66/277 - (23%)
Similarity:101/277 - (36%) Gaps:83/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RGRESP---IGSLECAPTLSSRKRQLSRFHPYHGSNIQLGDDATVAYRRASFADALTFSERPLAP 101
            |.||..   :|.|.........:..||......|:.:.|.|..:.|.||::|.|.:.||:||:.|
Mouse     7 RSREESRAIVGHLRGMHNAEVPREALSFHGNATGAQVHLDDQRSTARRRSTFHDGIVFSQRPVWP 71

  Fly   102 GDIFLVEIEKIERGWSGHMRLGLTELAPNVIRTSSEGLPHFALPDLANLGNSWIYPISKFEMNQR 166
            |:...:.:.:.|.||.|.:|:|.|.|.|..:..|.  ||.|..|||.....:|            
Mouse    72 GERVALRVLRHEEGWCGGLRVGFTRLDPAQVAASC--LPPFVCPDLEEQSPTW------------ 122

  Fly   167 QDANDIIEPETDDAPHRNLLGDATHVRTPRGLLPKRLLRPAMGNGNDSDILLTDKGSRIGIIYVP 231
                                         ..|||:..:|.    ||                 |.
Mouse   123 -----------------------------AALLPEGFVRA----GN-----------------VV 137

  Fly   232 TVQSDSKGELHFIINGVDRGPVSRDIPLNRAPLFVVIDVYGTTKQIRIIQLEGILSLQSACRNVI 296
            ....:.:|.|...:|......:.:|:.:..|||:.|:|||||||.|.::..:....::|.     
Mouse   138 CFWVNRRGWLFAKVNAGRPLLLRKDVLVQGAPLWAVMDVYGTTKAIELLDPKANAWIRSG----- 197

  Fly   297 LESFAEDAISELPLPES 313
                       .|:|||
Mouse   198 -----------EPVPES 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 54/215 (25%)
SOCS_SOCS_like 283..321 CDD:239687 5/31 (16%)
Neurl3XP_006495909.1 Neuralized 34..187 CDD:369249 54/216 (25%)
RING-HC_NEURL3 209..250 CDD:319466
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.