DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3894 and F10D7.5

DIOPT Version :9

Sequence 1:NP_611963.5 Gene:CG3894 / 37959 FlyBaseID:FBgn0035059 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_510818.3 Gene:F10D7.5 / 181767 WormBaseID:WBGene00017342 Length:617 Species:Caenorhabditis elegans


Alignment Length:217 Identity:54/217 - (24%)
Similarity:86/217 - (39%) Gaps:65/217 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RFHPYHGSNIQLGDDATVAYRRASFADALTFSERPLAPGDIFLVEIEKIERGWSGHMRLGLTELA 128
            :||..||||:.:..:..:|.||.||...|.||.||:...:...:.:.::...|||.:|.|:|...
 Worm    40 QFHCIHGSNVVILKNGRLAKRRESFCKGLAFSNRPIEIDENVCLRLCEVGTNWSGVLRFGVTNDD 104

  Fly   129 PNVIRTSSEGLPHFALPDLANLGNSWIYPISKFEMNQRQDANDIIEPETDDAPHRNLLGDATHVR 193
            |.:.|...  :|.||.|||......|                                       
 Worm   105 PEMYRDIP--VPTFACPDLTTKDGYW--------------------------------------- 128

  Fly   194 TPRGLLPKRLLRPAMGNGNDSDILLTDKGSRIGIIYVPTVQSDSKGELHFIINGVDRGPVSRDIP 258
              ...||:|.       .|:.:||         ..||     ::.|||.:.|||..:|.....|.
 Worm   129 --AKALPERY-------SNEGNIL---------HFYV-----NAHGELFYGINGSQKGMFLTGIN 170

  Fly   259 LNRAPLFVVIDVYGTTKQIRII 280
            ::| |:::::|:||.:..:.||
 Worm   171 VHR-PMWLILDIYGNSVGVEII 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3894NP_611963.5 SPRY_NHR_like 64..280 CDD:293945 52/215 (24%)
SOCS_SOCS_like 283..321 CDD:239687
F10D7.5NP_510818.3 NEUZ 37..158 CDD:128856 42/181 (23%)
NEUZ 248..370 CDD:128856
mRING-HC-C3HC5_NEU1 565..605 CDD:319561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6243
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.