DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3880 and Sapcd1

DIOPT Version :9

Sequence 1:NP_611962.2 Gene:CG3880 / 37957 FlyBaseID:FBgn0035057 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_036016736.1 Gene:Sapcd1 / 78376 MGIID:2388100 Length:164 Species:Mus musculus


Alignment Length:147 Identity:32/147 - (21%)
Similarity:50/147 - (34%) Gaps:45/147 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 GGSSSTSASAT------------------------DWSLALPAVPKKTSSKRRESRRHTLQHGID 234
            ||:|..||..|                        .|..|......:|||.              
Mouse     4 GGTSPGSALPTLEPWRAQVLVGHPWCKRPTLFCCYHWGQAAKTQEPRTSSS-------------- 54

  Fly   235 YNMLKRLKQLEEQRELLLFGLDGVEKARDWYMMQVLNVQEQIKYFGRLGTRF--DQWSELQQERL 297
             ..|:.::.||.:::.|..||:.:|..:.|:..::...|::....|.||..|  |..||.....|
Mouse    55 -GQLQMMQALEREQDALWQGLELLEHGQAWFADRLRETQQRQLQLGALGEDFLMDLHSETDAPLL 118

  Fly   298 NFQRARVFEANRSLQIL 314
                .|:.:.|..|..|
Mouse   119 ----TRIQKVNACLHSL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3880NP_611962.2 Suppressor_APC 234..315 CDD:288297 21/83 (25%)
Sapcd1XP_036016736.1 Suppressor_APC 57..132 CDD:402843 21/79 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14907
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.990

Return to query results.
Submit another query.