DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3880 and SAPCD1

DIOPT Version :9

Sequence 1:NP_611962.2 Gene:CG3880 / 37957 FlyBaseID:FBgn0035057 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001034740.1 Gene:SAPCD1 / 401251 HGNCID:13938 Length:178 Species:Homo sapiens


Alignment Length:127 Identity:32/127 - (25%)
Similarity:56/127 - (44%) Gaps:19/127 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 LKRLKQLEEQRELLLFGLDGVEKARDWYMMQVLNVQEQIKYFGRLGTRFDQWSELQQERLNFQRA 302
            |:|::.||.:::.|..||:.::..:.|:...:...|.|..:.|.||..|  .::|..|......|
Human    39 LRRMQALEREQDALWQGLELLQHGQAWFEDHLREAQRQQLHLGALGENF--LTDLHSEPGRPPLA 101

  Fly   303 RVFEANRSLQILADTWEHGGY-PLHINLAVPTPTVPKPRQMSDLLSRVREKPPLLSDLYEAQ 363
            ::.:.|..||.|.    |..: |..:|.|....|       .|...|.||:     :|::.|
Human   102 QIQKVNICLQNLI----HEKFSPSPLNKASSCTT-------QDSKERRREQ-----NLWQQQ 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3880NP_611962.2 Suppressor_APC 234..315 CDD:288297 20/76 (26%)
SAPCD1NP_001034740.1 Suppressor_APC 35..114 CDD:371516 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14907
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.990

Return to query results.
Submit another query.