DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3880 and T01B6.1

DIOPT Version :9

Sequence 1:NP_611962.2 Gene:CG3880 / 37957 FlyBaseID:FBgn0035057 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_508422.4 Gene:T01B6.1 / 187927 WormBaseID:WBGene00020134 Length:331 Species:Caenorhabditis elegans


Alignment Length:325 Identity:75/325 - (23%)
Similarity:127/325 - (39%) Gaps:62/325 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PSSGLLSFERFCAGLKLCLLRNQQN----AVEDLKLRPRSHGTLAPEMEFHSPAPPP-------- 142
            ||.||..|.           |...|    ::.|.:.:|..:|:....::......||        
 Worm     7 PSMGLNGFG-----------RRSHNFSSPSLVDYRSQPHHYGSQPSIVQNGGSQSPPDYALLFDA 60

  Fly   143 -------KPPRQVPKSPALGKDDIRHALQNWQLNLMADAGKSKTTQSREQFEHRGSADGGS-SST 199
                   |.|..|..:    |::.|...|....|:.    :.:..:||.|    .:|...| :|:
 Worm    61 PVVVLRSKKPSTVRSA----KEESRLRSQQPPSNIQ----RVQAIRSRPQ----STASYNSLASS 113

  Fly   200 SASATDWSLALPAVPKKTSSKRRESRRHTLQHGIDYNMLKRLKQLE-EQRELLLFGLDGVEKARD 263
            ......|..::      .||...::|||||....|...:.||:..: |:.|:|..|.|...|..:
 Worm   114 GMENLQWRNSV------MSSVTPDNRRHTLYDEEDNPRVARLEYFQGEESEMLKRGQDQATKLLE 172

  Fly   264 WYMMQVLNVQEQIKYFGRLGTRFDQWSELQQERLNFQRARVFEANRSLQILADTWEHGGYPLHIN 328
            ||..::|:||::.:...:.....|  ..:.:::|||.||.:.|.||.:..:.:|.:. |:|.|.|
 Worm   173 WYKERLLSVQKKARLLKQGSVSLD--PAVHEQKLNFLRAHITELNRRILAVMETSDK-GFPTHHN 234

  Fly   329 -LAVPTPT--------VPKPRQMSDLLSRVREKPPLLSDLYEAQHSHSHPQFLRAMPNFVLSQPS 384
             .|...|:        |...||...|...:.||..::..|.:........|..|...|..:.:||
 Worm   235 RTASNGPSTGANDDQLVWLHRQNQRLNQELAEKSRMIDQLKKENEMVKKSQVQRVERNVPIQRPS 299

  Fly   385  384
             Worm   300  299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3880NP_611962.2 Suppressor_APC 234..315 CDD:288297 23/81 (28%)
T01B6.1NP_508422.4 Suppressor_APC <158..216 CDD:288297 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006132
OrthoInspector 1 1.000 - - oto17321
orthoMCL 1 0.900 - - OOG6_110741
Panther 1 1.100 - - LDO PTHR14907
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5786
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.