DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spz6 and spz

DIOPT Version :9

Sequence 1:NP_611961.1 Gene:spz6 / 37956 FlyBaseID:FBgn0035056 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_524526.1 Gene:spz / 43256 FlyBaseID:FBgn0003495 Length:326 Species:Drosophila melanogaster


Alignment Length:331 Identity:68/331 - (20%)
Similarity:110/331 - (33%) Gaps:120/331 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LPKVTQIIRDEPVEQLDSNNIDRPYPAGGSTRVRRSLPEGVESNEYSYFDPALDEEEQH--KQRD 193
            :|..||  .|:|.::...|....|.|               |:|.:.:...:|.:.:|:  .||.
  Fly    57 MPIPTQ--HDDPTQKQKQNQNQSPIP---------------ETNRHYHQYHSLIQPDQYFKVQRS 104

  Fly   194 RNNQ------------QRR----AAEERKPRKFCDGGGVFCTLYRAIQGDTGGAAPATPTAERRE 242
            .|.:            ||.    .:|:..|.:......||               |.:|.|:.|.
  Fly   105 PNGKLNLVFNDTFVSLQRTDTEVQSEQPIPPRHPSDTFVF---------------PDSPIAKYRP 154

  Fly   243 EVGPIRYEGPPT----PCPAKVE------YATPVFAKNYQGAWRYVVQIPYEGYFTQTVEVTRCI 297
            ...|.|.....|    || ||.|      :.|.|..........:.::..:..:|:..::.|. :
  Fly   155 PQSPARPLRNDTKEHNPC-AKDESQHLRNFCTNVDDYPDLSGLTHKLKNNFAKFFSNDLQPTD-V 217

  Fly   298 QARCHYLDGGCLSSPRWVSLLVAEIFYP----NAEDT---VPTSSTTTQAPSVQ---------DF 346
            .:|.    ||  |..|::...:.::.||    .|:||   :..:....||..::         ||
  Fly   218 SSRV----GG--SDERFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDF 276

  Fly   347 -----QAY-----QQYLQKRAGVATASDGTSSGAAGPAAQVDAHCDGHDELGCFQVRLYYDWFLI 401
                 |:|     |.|.|:.. .:..|||                    ||...|     :.|.|
  Fly   277 AANFPQSYNPICKQHYTQQTL-ASIKSDG--------------------ELDVVQ-----NSFKI 315

  Fly   402 PGSCKC 407
            |..|||
  Fly   316 PSCCKC 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spz6NP_611961.1 Spaetzle 256..407 CDD:292695 37/182 (20%)
spzNP_524526.1 Spaetzle 228..321 CDD:292695 24/118 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23199
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.