DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spz6 and spz4

DIOPT Version :9

Sequence 1:NP_611961.1 Gene:spz6 / 37956 FlyBaseID:FBgn0035056 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_609504.2 Gene:spz4 / 34572 FlyBaseID:FBgn0032362 Length:597 Species:Drosophila melanogaster


Alignment Length:425 Identity:84/425 - (19%)
Similarity:124/425 - (29%) Gaps:147/425 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GFSQPQQQSP---SDYGEEQP-PEGYYAFVESPNAVPPKVRPPPYTFVNAECKDVAAGKKSAV-- 77
            |.:.|..:.|   :|..|.|| ||.        |:|...|.|...:..:......|||:...:  
  Fly   223 GTAPPLHEKPESETDIVEIQPSPES--------NSVYEVVSPSVLSTTSTAKPSSAAGENIQIID 279

  Fly    78 ----SVHNICGDLNKGQIPKNPLGQNVLGEPYPFELIRNQTLKFLSKTLPVLK---ADDTL---- 131
                .:.|:..:.:..|.|...    ..|:|        .::...:..||:.|   |:.|.    
  Fly   280 SPQLGLRNLSAEASPSQEPPTA----TTGKP--------TSVPKSTTPLPIRKRKPAETTTSAAS 332

  Fly   132 PKVTQIIRDEPVEQ---LDSNNIDRPYPAGGSTRVR-RSLPEGVESNEYSYFDPALDEEEQHKQR 192
            |||:..|.......   |...|:.:..||..:|.|. .||..|..|..:|         .:..:|
  Fly   333 PKVSSTISTPTTTTATLLIRRNVTKYSPASVTTPVSFASLFSGTSSGLFS---------PERLRR 388

  Fly   193 DRNNQQRRAAEERKPRKFCDGGGVFCTLYRAIQGDTGGAAPA--------TPTAERREEVGPIRY 249
            ........:|....|    ..||.      .....||.|:.:        ...|.::|.|.....
  Fly   389 PLTTTSSTSAPASSP----PAGGT------PASSSTGSASKSGLLREGQLFQDAMKQEPVAVASN 443

  Fly   250 EGPPTPCPAKVEYATPVFAKNYQGAWRYVVQI-PYEGYFTQTVEVTRCI----QARCHYLDGGCL 309
            ......||.|.|...|.:|.|.:|....::.: |:|.|    |...:|.    |..|.   .|| 
  Fly   444 LRGVNACPVKDEVVAPFWANNTRGEVLALLNLYPFEQY----VHWEKCTHEFKQMFCR---DGC- 500

  Fly   310 SSPRWVSLLVAEIFYPNAEDTVPTSSTTTQAPSVQDFQAYQQYLQKRAGVATASDGTSSGAAGPA 374
                                                 :..|||...|                 .
  Fly   501 -------------------------------------RCEQQYRLHR-----------------L 511

  Fly   375 AQVDAH--CDGHDELGCFQVRLYYDWFLIPGSCKC 407
            ...|.|  |.|          ::.|||..|.||.|
  Fly   512 LAYDPHNECRG----------IFSDWFRFPSSCIC 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spz6NP_611961.1 Spaetzle 256..407 CDD:292695 31/157 (20%)
spz4NP_609504.2 Spaetzle 448..536 CDD:292695 31/159 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23199
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.