DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mid1 and Nalf2

DIOPT Version :10

Sequence 1:NP_001033972.1 Gene:Mid1 / 37953 FlyBaseID:FBgn0053988 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001074752.1 Gene:Nalf2 / 620592 MGIID:3648377 Length:471 Species:Mus musculus


Alignment Length:60 Identity:17/60 - (28%)
Similarity:23/60 - (38%) Gaps:11/60 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   880 PCLSVCQTVEQKCPYLLPADRAPALPTQYAGEPTFLCLDQNIPETGAQLEKSSYGPNDCC 939
            ||...|..|:.:||::||.:....    |.|.|.|:|       ||............||
Mouse   310 PCKQYCLEVQTRCPFILPDNEEMV----YGGLPGFIC-------TGLMDTSPKRPETKCC 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mid1NP_001033972.1 Mid1 <651..>676 CDD:432882
Nalf2NP_001074752.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..115
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..178
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..424
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.