DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and ST3GAL5

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_003887.3 Gene:ST3GAL5 / 8869 HGNCID:10872 Length:418 Species:Homo sapiens


Alignment Length:366 Identity:87/366 - (23%)
Similarity:130/366 - (35%) Gaps:94/366 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LKVSKNTKLTLSPKLYLCHDKHSELCHNKTQQFRQRIVR-AFEKAMVESVNESQANHYNVDYKPV 186
            ||::..|:.....|::.....|.:......||..|:..| .|.|..:..:.|   :.|:||..|.
Human    83 LKLNYTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFE---HRYSVDLLPF 144

  Fly   187 F----GDSFEEQYYPSTCLVMEAGVRVLRRKDAPFNKLPFG-------RLFPRQKLFRNV--KDI 238
            .    .||..|..|                 |.||....|.       .|.|...|..::  |..
Human   145 VQKAPKDSEAESKY-----------------DPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTC 192

  Fly   239 KTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKPE----- 298
            :.|.::.|.|.|.|.:||..::..|:|:|.|.||.:|:...||:|||||      :|.||     
Human   193 RRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGNKTTIR------MTYPEGAPLS 251

  Fly   299 ------FDFTRAPIFRNVTIAAWDPGKYNGTLEDWLTSADYDLF-------------SNYELYRR 344
                  .|...|.:|::|............||..|:.     ||             .::.:...
Human   252 DLEYYSNDLFVAVLFKSVDFNWLQAMVKKETLPFWVR-----LFFWKQVAEKIPLQPKHFRILNP 311

  Fly   345 RYPKSRAFLI----DPHSVWRLWQSLQMFAGNRPISKNPPSSGFIGLALLLPHCPQVDFVEY--- 402
            ...|..||.|    :|.|  |.|..          .||.|:.|.|.:.|....|.:|....:   
Human   312 VIIKETAFDILQYSEPQS--RFWGR----------DKNVPTIGVIAVVLATHLCDEVSLAGFGYD 364

  Fly   403 --VPSTRLNGRCHYYSKEMNSACTFGSWHPLAAEKLMALDM 441
              .|.|.|    ||:..:..:|..|.:.|.:..|....|.:
Human   365 LNQPRTPL----HYFDSQCMAAMNFQTMHNVTTETKFLLKL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 62/247 (25%)
ST3GAL5NP_003887.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Glyco_transf_29 144..410 CDD:279159 71/302 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.