DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and AT3G48820

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_190451.2 Gene:AT3G48820 / 824043 AraportID:AT3G48820 Length:440 Species:Arabidopsis thaliana


Alignment Length:243 Identity:59/243 - (24%)
Similarity:98/243 - (40%) Gaps:57/243 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 FPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVN 290
            ||||        ...||::.::|.|..:|.|:.|||:|.|:|.|.||.|.::..||.|:|.|::|
plant   168 FPRQ--------FGRCAVIGNSGDLLKTKFGKEIDTYDTVLRENGAPIQNYKEYVGEKSTFRLLN 224

  Fly   291 -------SQVVTKPE------------FDF---------TRAPIFRNVTIAAWDPGKYNG--TLE 325
                   .:||...|            .|.         .:.|::..:..:.....|..|  .||
plant   225 RGSAKALDKVVELDEKKQEVLLVKTTIHDIMNKMIREVPIKNPVYLMLGASFGSAAKGTGLKALE 289

  Fly   326 DWLTSADYDLFSNYELYRRRYPKSRAFLIDP-HSVWRLWQSLQMFAGNRPISKNPPSSGFIGLAL 389
            ..|::.|     :.::|        .|.:|| :..|..:.| :...|:.|:...........|.|
plant   290 FALSTCD-----SVDMY--------GFTVDPGYKEWTRYFS-ESRQGHTPLHGRAYYQMMECLGL 340

  Fly   390 LLPHCP-QVD---FVEYVPSTRLNGRCHYYSKEMNSACTFGSWHPLAA 433
            :..|.| :.|   .|::|||..........::::......||..|||:
plant   341 IKIHSPMRADPNRVVKWVPSRSTIRSARIAAEKLLRRVGAGSADPLAS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 59/243 (24%)
AT3G48820NP_190451.2 Glyco_transf_29 160..332 CDD:395627 45/185 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.