DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and ST6GALNAC5

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_112227.1 Gene:ST6GALNAC5 / 81849 HGNCID:19342 Length:336 Species:Homo sapiens


Alignment Length:238 Identity:60/238 - (25%)
Similarity:101/238 - (42%) Gaps:37/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 KTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVV---NSQVVTKPEFD 300
            :.||:|:|:|.|..|:.|..||..:.|:|.|.|||:|:..|||::|::||:   :.|.:.:...|
Human    94 RDCALVTSSGHLLHSRQGSQIDQTECVIRMNDAPTRGYGRDVGNRTSLRVIAHSSIQRILRNRHD 158

  Fly   301 FTRAPIFRNVTIAAWDPGKYNGTLEDWLTSADYDLFSNYELYRRRYPKSRAFLIDPHSVWRLWQS 365
            ...  :.:......|.|..|      ........:::|..|..:..|:.:||:|..|.:.:..:.
Human   159 LLN--VSQGTVFIFWGPSSY------MRRDGKGQVYNNLHLLSQVLPRLKAFMITRHKMLQFDEL 215

  Fly   366 LQMFAG-NRPISKNPPSSGFIGLALLLPHCPQVDFVEYVPSTRLNGRC----------HYYSKEM 419
            .:...| :|.||....|:|:..:.:.|..|.:::....||.    ..|          |||....
Human   216 FKQETGKDRKISNTWLSTGWFTMTIALELCDRINVYGMVPP----DFCRDPNHPSVPYHYYEPFG 276

  Fly   420 NSACTF---------GSWHPLAAEKLMALDMNMAEDDDMSVFQ 453
            ...||.         ||.|....||  .:..|.|...::..||
Human   277 PDECTMYLSHERGRKGSHHRFITEK--RVFKNWARTFNIHFFQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 56/220 (25%)
ST6GALNAC5NP_112227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..81
Glyco_transf_29 92..275 CDD:307084 49/192 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.