DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st8sia2

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001072338.1 Gene:st8sia2 / 779791 XenbaseID:XB-GENE-960442 Length:370 Species:Xenopus tropicalis


Alignment Length:246 Identity:68/246 - (27%)
Similarity:101/246 - (41%) Gaps:42/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVV 289
            |.||....:| |..||||||.::|.|..|..|:.||:||.|:|.|.||.:.:..|||:||.:..:
 Frog   137 LLPRTSPLKN-KHFKTCAIVGNSGILLNSGCGKEIDSHDFVIRCNLAPVEEYATDVGTKTNLVTM 200

  Fly   290 NSQVVTKPEFD---------FTRAPIFRNVTIAAWDP---GKYNGTLEDWLTSADYDLFSNYEL- 341
            |..||.:...|         |.:.....|.:| .|.|   .|......:|:.    ||...:.: 
 Frog   201 NPSVVQRAFEDLVNDTWKDKFLQRLKSLNESI-LWIPAFMAKGGEERVEWVN----DLIIKHHIN 260

  Fly   342 YRRRYPKSRAFLIDPHSVWRLWQSLQMFAGNRPISKNPPSSGFIGLALLLPHCPQVDFVEYVPST 406
            ....||..|..    |:|...|.:      |:...|. |::|.:...|....|.::....:.|..
 Frog   261 VHTAYPSLRLL----HAVRGYWLT------NKVHIKR-PTTGILMYTLATRFCNRIYLYGFWPFP 314

  Fly   407 R-LNG---RCHYYSKEMNSACTFGSWH--PLAAEKLM------ALDMNMAE 445
            | |:.   :.|||........:....|  ||..:.|.      ||.:|:.|
 Frog   315 RDLHQNPVKYHYYDSLKYGYTSQAGPHAMPLEFKALKNLHLQGALKLNVGE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 63/230 (27%)
st8sia2NP_001072338.1 Glyco_transf_29 104..361 CDD:307084 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.