DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st6galnac4

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001072307.1 Gene:st6galnac4 / 779760 XenbaseID:XB-GENE-953044 Length:288 Species:Xenopus tropicalis


Alignment Length:246 Identity:68/246 - (27%)
Similarity:99/246 - (40%) Gaps:64/246 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 FNKLPFGRLFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVG 281
            :::||.|     |.|.||  ..|:||:|||:|.:.||.||..||..:.|:|.|.|||.|:|.|||
 Frog    47 YSRLPDG-----QPLSRN--PCKSCAVVSSSGQMLGSGLGPQIDQAECVLRMNTAPTLGYEADVG 104

  Fly   282 SKTTIRVVNSQVVTKPEFDFTRAP-IFRNVT----------IAAWDPGKYNGTLEDWLTSADYDL 335
            |::::|||:          .|..| :.||.|          ...|.|          |...|.|.
 Frog   105 SRSSLRVVS----------HTSVPLLLRNQTYFFQQSQDTVYVIWGP----------LRQMDIDS 149

  Fly   336 FSNYELYRR---RYPKSRAFLIDPHSVWRLWQSLQMFAG---------NRPISKNPPSSGFIGLA 388
            ...|.:.:.   .||:.:        ::.|.||:.....         ||.:|....|:|:..:.
 Frog   150 GITYRVLQHTKGMYPQVQ--------IYTLTQSMMAHCDLVFQNETGKNRAMSGTFLSTGWFTMI 206

  Fly   389 LLLPHCPQVDFVEYVPSTRLNGR------CHYYSKEMNSACTFGSWHPLAA 433
            |.:..|.::.....|.......|      .|||.|.....||....|..|:
 Frog   207 LAMELCEEITVYGMVGENYCRNRFNPPVPYHYYEKGRLDECTMYMMHERAS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 65/239 (27%)
st6galnac4NP_001072307.1 Glyco_transf_29 47..253 CDD:307084 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.