DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st3gal1l2

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_002667882.1 Gene:st3gal1l2 / 751766 ZFINID:ZDB-GENE-120426-1 Length:317 Species:Danio rerio


Alignment Length:260 Identity:74/260 - (28%)
Similarity:110/260 - (42%) Gaps:64/260 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 FEEQYYPSTCLVMEAGVRVL-------------RRKDAPFNKL--PFGRLFPRQKLFRNVKD--I 238
            |.|.:.||..|::..|..||             .:||:.:..:  ....|||.:..:.|...  .
Zfish    55 FNELFDPSIQLLLTRGNYVLNKDVYKYWKGLQKNKKDSDYRAVVEKMFSLFPDKTRYTNASPNRC 119

  Fly   239 KTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKPEFDFTR 303
            :||||:.::|:|.||:.||.||.|:.|:|.|..||:|:|.|||||||.|.:      .||    .
Zfish   120 RTCAIIGNSGNLKGSRYGRLIDAHNFVIRINMGPTKGYEDDVGSKTTHRFI------YPE----S 174

  Fly   304 APIFRNVTIAAWDPGKYNGTLE-DWLTSADYDLFSNYELYRRRYPKSRA---------FLIDP-- 356
            |..|.|.|.....|.|   .|: :||.|:    |:...: .|.|.|.||         .::.|  
Zfish   175 AVDFDNSTYLVLSPFK---VLDIEWLISS----FTTKNI-TRTYKKVRASINANRHKVMILHPAF 231

  Fly   357 ----HSVWRLWQSLQMFAGNRPISKNPPSSGFIGLALLLPHCPQVDFVEYVPSTRLNGRCHYYSK 417
                |.:|.:...            ..||:||:.:...|..|.||....: .:.:.....||:.|
Zfish   232 IKYVHEIWLVKHG------------KYPSTGFLAIIFALHICDQVSTFGF-GADQYGNWYHYFEK 283

  Fly   418  417
            Zfish   284  283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 64/212 (30%)
st3gal1l2XP_002667882.1 Glyco_transf_29 64..315 CDD:279159 70/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.