DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and ST8SIA1

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_003025.1 Gene:ST8SIA1 / 6489 HGNCID:10869 Length:356 Species:Homo sapiens


Alignment Length:264 Identity:65/264 - (24%)
Similarity:103/264 - (39%) Gaps:72/264 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAP-TQGHEVDVGSKTTIRV 288
            |||:...|:  ..:|.||:|.:.|.|..|..||.||..:.|||.|..| :..:..|||||:.:..
Human   124 LFPQATPFQ--LPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVT 186

  Fly   289 VNSQVVTKPEFD---FTRAPIFRNVTIAAWDPGKYN-------------GT---LEDWLTSADYD 334
            .|..:: :..|.   ::|.....|:.|       ||             ||   |..:.|.:|..
Human   187 ANPSII-RQRFQNLLWSRKTFVDNMKI-------YNHSYIYMPAFSMKTGTEPSLRVYYTLSDVG 243

  Fly   335 -----LFSNYELYRRRYPKSRAFLIDPHSVWRLWQSLQMFAGNRPISKNPPSSGFIGLALLLPHC 394
                 ||:|....|              |:.:.|:|       |.|.....|:|...::..|..|
Human   244 ANQTVLFANPNFLR--------------SIGKFWKS-------RGIHAKRLSTGLFLVSAALGLC 287

  Fly   395 PQVDFVEYVP-STRLNGR---CHYYSKEMNSACTFGSWHPLAAE--------KLMALDMNMAEDD 447
            .:|....:.| |..::.:   .|||    ::...|..:|.:..|        |:.||.|.:...:
Human   288 EEVAIYGFWPFSVNMHEQPISHHYY----DNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCE 348

  Fly   448 DMSV 451
            |.|:
Human   349 DTSL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 60/248 (24%)
ST8SIA1NP_003025.1 Glyco_transf_29 92..344 CDD:366297 63/254 (25%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O43173 188..190 1/1 (100%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O43173 274..276 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.