DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and ST3GAL3

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_016857598.1 Gene:ST3GAL3 / 6487 HGNCID:10866 Length:503 Species:Homo sapiens


Alignment Length:236 Identity:64/236 - (27%)
Similarity:91/236 - (38%) Gaps:66/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PFG------------------RLFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMR 267
            |||                  ||.|.....|    .:.|.||.:.|.||...||..||.:|||:|
Human   195 PFGIKGQDNLIKAILSVTKEYRLTPALDSLR----CRRCIIVGNGGVLANKSLGSRIDDYDIVVR 255

  Fly   268 FNHAPTQGHEVDVGSKTTIRVVNSQ-VVTKPEFDFTRAPIFRNVTIAA--WDPGKYNGTLEDWLT 329
            .|.||.:|.|.|||||||:|:...: .:.:|| .:.|..:|   .:|.  |...|       || 
Human   256 LNSAPVKGFEKDVGSKTTLRITYPEGAMQRPE-QYERDSLF---VLAGFKWQDFK-------WL- 308

  Fly   330 SADYDLFSNYELYRRRYPKSRAF----------------LIDPHSVWRLWQSLQMFAGNRPI--S 376
                    .|.:|:.|...|..|                :::|:.:.....:|.....|..:  .
Human   309 --------KYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGR 365

  Fly   377 KNPPSSGFIGLALLLPHCPQVDFV--EYVPSTRLNGRCHYY 415
            .|.|:.|.:.:.:.|..|.:|...  .|..||. |...|||
Human   366 GNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTP-NAPLHYY 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 61/215 (28%)
ST3GAL3XP_016857598.1 Glyco_transf_29 176..419 CDD:279159 64/236 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.