DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and ST6GAL1

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001340845.1 Gene:ST6GAL1 / 6480 HGNCID:10860 Length:406 Species:Homo sapiens


Alignment Length:280 Identity:107/280 - (38%)
Similarity:155/280 - (55%) Gaps:6/280 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 NESQANHYNVDYK-PVFGDSFEEQYYPSTCLVME-AGVRVLRRKDAPFNKLPFGRLFPRQKLFRN 234
            |....|.|.|.|| |..|..|..:  ...|.:.: ..|.::...|.|||...:....|::.:...
Human   115 NYLSMNKYKVSYKGPGPGIKFSAE--ALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTK 177

  Fly   235 VKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKPEF 299
            ......||:|||||||..|:|||.||.||.|:|||.|||...:.|||:|||||::|||:|| .|.
Human   178 AGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVT-TEK 241

  Fly   300 DFTRAPIFRNVTIAAWDPGKYNGTLEDWLTSADYDLFSNYELYRRRYPKSRAFLIDPHSVWRLWQ 364
            .|.:..::....:..|||..|:..:..|..:.||:.|:||:.||:.:|....:::.|...|.||.
Human   242 RFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWD 306

  Fly   365 SLQMFAGNRPISKNPPSSGFIGLALLLPHCPQVDFVEYVPSTRLNGRCHYYSKEMNSACTFGSWH 429
            .||..:... |..||||||.:|:.:::..|.|||..|::||.|....|:||.|..:||||.|::|
Human   307 ILQEISPEE-IQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYH 370

  Fly   430 PLAAEKLMALDMNMAEDDDM 449
            ||..||.:...:|...|:|:
Human   371 PLLYEKNLVKHLNQGTDEDI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 89/212 (42%)
ST6GAL1NP_001340845.1 Glyco_transf_29 169..384 CDD:307084 89/216 (41%)
Substrate binding. /evidence=ECO:0000269|PubMed:23999306, ECO:0007744|PDB:4JS1 322..324 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 200 1.000 Domainoid score I3039
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3770
Isobase 1 0.950 - 0 Normalized mean entropy S7453
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D231534at33208
OrthoFinder 1 1.000 - - FOG0002913
OrthoInspector 1 1.000 - - otm40867
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46059
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1922
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.