DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St3gal3

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_113885.1 Gene:St3gal3 / 64445 RGDID:68414 Length:374 Species:Rattus norvegicus


Alignment Length:224 Identity:61/224 - (27%)
Similarity:92/224 - (41%) Gaps:52/224 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 KTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQ-VVTKPEFDFT 302
            :.|.||.:.|.||...||..||.:|||:|.|.||.:|.|.|||||||:|:...: .:.:|| .:.
  Rat   157 RRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPE-QYE 220

  Fly   303 RAPIFRNVTIAA--WDPGKYNGTLEDWLTSADYDLFSNYELYRRRYPKSRAF------------- 352
            |..:|   .:|.  |...|       ||         .|.:|:.|...|..|             
  Rat   221 RDSLF---VLAGFKWQDFK-------WL---------KYIVYKERVSASDGFWKSVATRVPKEPP 266

  Fly   353 ---LIDPHSVWRLWQSLQMFAGNRPI--SKNPPSSGFIGLALLLPHCPQVDFVEY-----VPSTR 407
               :::|:.:.....:|.....|..:  ..|.|:.|.:.:.:.|..|.:|....:     .|   
  Rat   267 EIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALDGCDEVAVAGFGYDMNTP--- 328

  Fly   408 LNGRCHYYSKEMNSACTFGSW-HPLAAEK 435
             |...||| :.:..|....|| |.:..||
  Rat   329 -NAPLHYY-ETVRMAAIKESWTHNIQREK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 61/224 (27%)
St3gal3NP_113885.1 Glyco_transf_29 106..370 CDD:279159 61/224 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.