DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st6galnac5a

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_692047.5 Gene:st6galnac5a / 563594 ZFINID:ZDB-GENE-070705-488 Length:325 Species:Danio rerio


Alignment Length:229 Identity:54/229 - (23%)
Similarity:92/229 - (40%) Gaps:52/229 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 KTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAP-TQGHEVDVGSKTTIRVV---NSQVVTKPEF 299
            ::||:|:|:|.|.|...|:.||..:.|:|.|.|| .:|:..|||.:|::||:   :.|.|.:...
Zfish    77 RSCALVTSSGHLTGGGRGKEIDQAECVIRMNDAPIARGYGADVGHRTSLRVIAHSSMQRVLRSRH 141

  Fly   300 DFTRAPIFRNVTIAAWDPGKY-----NGTLEDWLTSADYDLFSNYELYRRRYPKSRAFLIDPHSV 359
            :...:.  :......|.|..|     .|.           :::|..|..:..||.:.::|.    
Zfish   142 ELLNSS--QETVFIFWGPSSYMRRDGKGL-----------VYNNLRLMNQVLPKLKVYIIS---- 189

  Fly   360 WRLWQSLQMF--------AGNRPISKNPPSSGFIGLALLLPHCPQVDFVEYVP------STRLNG 410
               ||.:..|        ..:|.|:.:..|:|:..:.:.|..|.:::....||      |...:.
Zfish   190 ---WQKMLQFDDLFKRETGKDRRITNSWLSTGWFTMTIALELCDRINVYGMVPPDFCRESQHSSV 251

  Fly   411 RCHYYSKEMNSACTF---------GSWHPLAAEK 435
            ..|||.......|..         ||.|....||
Zfish   252 PYHYYEPTGPDECAMYISHERGRRGSHHRFITEK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 54/229 (24%)
st6galnac5aXP_692047.5 Glyco_transf_29 63..270 CDD:279159 49/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.