DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st8sia2

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_705948.1 Gene:st8sia2 / 555134 ZFINID:ZDB-GENE-020919-4 Length:381 Species:Danio rerio


Alignment Length:382 Identity:83/382 - (21%)
Similarity:142/382 - (37%) Gaps:92/382 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 FHVRWNPNEKFIVESRENPAINS--SKLAPHPRLKVSKNTKLTLSP---KLYLCHDKHSELCHNK 151
            ||::     ...::|..:..:|:  :.|..:.:.|||.    ..||   |....:...||...|:
Zfish    41 FHLK-----SVALQSNRSSDLNAAPTSLVTYRKSKVSS----LASPSDIKRKTSNSSSSEWTFNR 96

  Fly   152 T--QQFRQRIVRAFEKAMVESVNESQANHYNVDYKPVFGD----SFEEQYYPSTCLVMEAGVRVL 210
            |  ...|:.|::..:.....|:.:|       .:||  ||    .|:.|   ||..:.|      
Zfish    97 TLSNLIRKNILKFLDAERDISILKS-------TFKP--GDVIHYIFDRQ---STTNISE------ 143

  Fly   211 RRKDAPFNKLPFGRLFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQG 275
                      ....|.|.....:| :..:.||||.::|.|..|..||.||:||.|:|.|.||.:.
Zfish   144 ----------NLYHLLPTVSPMKN-QHYRKCAIVGNSGILLNSSCGREIDSHDFVIRCNLAPVEE 197

  Fly   276 HEVDVGSKTTIRVVNSQVVTKPEFDFTRAPIFRNVTIAAW------DPGKYNGTL---------- 324
            :..|||.:|::..:|..||.:         .|:::....|      .|...:|::          
Zfish   198 YAADVGLRTSLVTMNPSVVQR---------AFQDLNSEEWVQRFVQRPQSLSGSVLWIPAFMAKG 253

  Fly   325 -EDWLTSADYDLFSNYELYRRRYPKSRAFLIDPHSVWRLWQSLQMFAGNRPISKNPPSSGFIGLA 388
             |:.:..|...:..:....|..:|..|..    |:|...|.:       ..:....|::|.:...
Zfish   254 GEERVEWAIRLILLHTVNVRTAFPSLRLL----HAVRGYWLT-------NHVQIKRPTTGLLMYT 307

  Fly   389 LLLPHCPQVDFVEYVPSTR-LNG---RCHYYSKEMNSACTFGSWH--PLAAEKLMAL 439
            :....|.::....:.|... .:|   :.|||........:..|.|  ||....|.||
Zfish   308 MATRFCDEIHLYGFWPFAHDPDGKPVKYHYYDTLTYHYTSSASPHTMPLEFRTLSAL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 52/235 (22%)
st8sia2NP_705948.1 Glyco_transf_29 115..374 CDD:279159 66/299 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.