DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st8sia3

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001106903.1 Gene:st8sia3 / 553510 ZFINID:ZDB-GENE-060228-4 Length:374 Species:Danio rerio


Alignment Length:407 Identity:96/407 - (23%)
Similarity:142/407 - (34%) Gaps:118/407 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PRS-VFHVRWNPN--EKFIVESRENPAINSSKLAPHPRLKVSKNTKLTLSPKLYLCHD--KHSEL 147
            ||. :||..:...  .||:     :||..|...|.:..|:.|.|.:...|....|..:  :|.::
Zfish    45 PRMYMFHAGFRSQLAMKFL-----DPAFTSLNTALNENLQESSNWRFNRSAYAELSKEIAQHIDV 104

  Fly   148 CHNKTQQFRQRIVRAFEKAMVESVNESQANHYNVDYKPVFGDSFEEQYYPSTCLVMEAGVRVLRR 212
            .||.|             ....||...|..||:               |.|...|...|.. || 
Zfish   105 PHNFT-------------LTKNSVRVGQLMHYD---------------YSSHKYVFSIGEN-LR- 139

  Fly   213 KDAPFNKLPFGRLFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHE 277
                       .|.|......| |...|||:|.::|.|.||:.|..||.:|.|.|.|.|||:...
Zfish   140 -----------SLLPDASPVLN-KRYNTCAVVGNSGILTGSRCGPEIDKYDFVFRCNFAPTEVFR 192

  Fly   278 VDVGSKTTIRVVNSQVVTKPEFDFTRAPIFRNVTIAAWDPGKYNGTLED------WL------TS 330
            .|||.:|.:...|..::.|          :.|..:...|...:..:|:.      |:      ||
Zfish   193 RDVGRRTNLTTFNPSILEK----------YYNNLLTIQDRNNFFLSLKKLDGAILWIPAFFFHTS 247

  Fly   331 AD-----YDLFSNYELYRRRYPKSRAFLIDPHSVW----RLWQSLQMFAGNRPISKNPPSSGFIG 386
            |.     .|.|..::      .:.:..|..|.::.    |.|::.|       :|....|:|.:.
Zfish   248 ATVTRTLVDFFVEHK------GQLKVQLAWPGNIMQYVNRYWKTKQ-------LSPKRLSTGILM 299

  Fly   387 LALLLPHCPQVDFVEY-----VPSTRLNGRCHYYSKEMNSACTFGSW---HPLAAE-KLMALDMN 442
            ..|....|.||....:     .|:|......|||.|:.....|  .|   |.|..| ||:   ..
Zfish   300 FTLASSLCEQVHLYGFWPFGWDPNTGKELPYHYYDKKGTKFTT--KWQESHQLPTEFKLL---FK 359

  Fly   443 MAEDDDMSVFQFGILRI 459
            |..|        |:|::
Zfish   360 MHAD--------GVLKL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 61/242 (25%)
st8sia3NP_001106903.1 Glyco_transf_29 107..368 CDD:279159 79/338 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.