DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st8sia4

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001092886.1 Gene:st8sia4 / 553211 ZFINID:ZDB-GENE-060322-10 Length:358 Species:Danio rerio


Alignment Length:213 Identity:51/213 - (23%)
Similarity:84/213 - (39%) Gaps:44/213 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVV 289
            |.|.....:| |..||||:|.::|.|..|..|:.||.|..|:|.|.||.:|...|||.::....:
Zfish   126 LLPEVSPLKN-KTFKTCAVVGNSGILLKSGCGKEIDNHSFVIRCNLAPLEGFADDVGLRSDFTTM 189

  Fly   290 NSQVV----------TKPEFDFTRAPIFRNVTIAAWDPG-------KYNGTLEDWLTSADYDLFS 337
            |..|:          |:.|....|.....:..:  |.|.       |:..|:.        :|..
Zfish   190 NPSVIQRVYGGLREETQQENLIQRLRQLNDSVL--WIPAFMVKGGMKHVDTVN--------ELIL 244

  Fly   338 NYEL-YRRRYPKSRAFLIDPHSVWRLWQSLQMFAGNRPISKNPPSSGFIGLALLLPHCPQVDFVE 401
            .::| .|..||..|..    |:|...|.:       ..|:...|::|.:...:....|.::....
Zfish   245 KHKLKVRTAYPSLRLI----HAVRGFWLT-------NKINIKRPTTGLLMYTMATRFCDEIYLYG 298

  Fly   402 YVPSTR-LNG---RCHYY 415
            :.|..: .:|   :.||:
Zfish   299 FWPFPKDASGNPVQYHYF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 51/213 (24%)
st8sia4NP_001092886.1 Glyco_transf_29 93..352 CDD:279159 51/213 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.