DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st8sia1

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001314770.1 Gene:st8sia1 / 553210 ZFINID:ZDB-GENE-051005-1 Length:339 Species:Danio rerio


Alignment Length:237 Identity:54/237 - (22%)
Similarity:97/237 - (40%) Gaps:42/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 IKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAP-TQGHEVDVGSKTTIRVVNSQVVTKPEFDF 301
            :|.|::|.:.|.|..|..|..||..|.:||.|..| ::.:..|||:||.:...|..::.|.    
Zfish   116 LKRCSVVGNGGVLKHSGCGNEIDRADFIMRCNLPPLSKDYTDDVGTKTHLVSANPSIIEKS---- 176

  Fly   302 TRAPIFRNVTIAAWDPGKYNGTLEDWLTSADYDLFSNYELYRRRYPKSRAF--LIDPHSVWRL-- 362
                 |:|:   .|....:..:::.:  .:.|.....:.:.....|..||:  |.|..|...:  
Zfish   177 -----FQNL---LWSRKSFVESMKAY--GSSYIYIPAFSMKPGTDPSLRAYHALADSSSNQTVLF 231

  Fly   363 -----WQSLQMFAGNRPISKNPPSSGFIGLALLLPHCPQVDFVEYVP-STRLNGR---CHYYSKE 418
                 .:::.:|..|..:.....|:|...::|.|..|.:|....:.| |..|:.|   .|||...
Zfish   232 ANPDFLKNVGIFWKNHGVHGKRLSTGLFLVSLALGLCEEVTAYGFWPFSVGLDERPVSHHYYDNI 296

  Fly   419 MNSACTFGSWHPLAAEKLMALDMNMAEDDDMSVFQFGILRIR 460
            :.|:    .:|.:..|.|....::.:          |.||:|
Zfish   297 LPSS----RFHAMPEEFLQLWHLHKS----------GTLRMR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 49/212 (23%)
st8sia1NP_001314770.1 Glyco_transf_29 72..323 CDD:279159 52/234 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.