DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st3gal8

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001004017.1 Gene:st3gal8 / 445567 ZFINID:ZDB-GENE-050417-286 Length:341 Species:Danio rerio


Alignment Length:203 Identity:51/203 - (25%)
Similarity:77/203 - (37%) Gaps:50/203 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 PRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVV-- 289
            |||...|.      ||:|.::|:|..||.|..||:|..|:|.|.|.|.|::.|||.:||...:  
Zfish   137 PRQNQCRK------CAVVGNSGNLLKSKYGALIDSHSTVIRMNKAVTVGYDEDVGYRTTHHFLYP 195

  Fly   290 NSQVVTKPEFDFTRAPIFRNVTIAAWDPGKYNGTLED--WLTSA--DYDLFSNYELYRRRY--PK 348
            .|.:..:|.......|.                .|:|  ||:||  ..::...|...:.|.  .|
Zfish   196 ESAIHLRPGVHLVLLPF----------------KLKDMQWLSSALSTGEIKMTYMRVKNRIDADK 244

  Fly   349 SRAFLIDP------HSVWRLWQSLQMFAGNRPISKNPPSSGFIGLALLLPHCPQVDFVEYVPSTR 407
            .:..:::|      |..|.....            ..||:|.:.:...|..|.:|....|  ...
Zfish   245 DKVMVVNPAFFKYTHDRWTERHG------------RYPSTGIVAIIFALHLCDEVSVFGY--GAD 295

  Fly   408 LNGRCHYY 415
            ..|..|:|
Zfish   296 AQGNWHHY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 51/203 (25%)
st3gal8NP_001004017.1 Glyco_transf_29 89..341 CDD:279159 51/203 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.