DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st3gal2

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_009291823.1 Gene:st3gal2 / 445562 ZFINID:ZDB-GENE-050419-181 Length:398 Species:Danio rerio


Alignment Length:279 Identity:68/279 - (24%)
Similarity:102/279 - (36%) Gaps:95/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 PVFGDSFEEQYYPSTCLVMEAGVR--------------VLRRKDAPFN--------------KLP 221
            |...|.|:|.|.|.   :....:|              :|:.:..|.|              :.|
Zfish   127 PGVSDWFDENYDPD---ISPVWIRDNIQLPSDVYYWWVMLQPQFKPHNIQQVLQRLFQVIPGRSP 188

  Fly   222 FGRLFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTI 286
            :|...|.:.|        .||:|.::|:|.|:..|..||.||.:||.|.|||.|:|.|.||:||.
Zfish   189 YGSWDPARCL--------RCAVVGNSGNLRGAGYGPVIDGHDFIMRMNLAPTVGYEEDAGSRTTH 245

  Fly   287 RVV--NSQVVTKPEFDFTRAPIFRNVTIAAWDPGKYNGTLEDWLTSADYDLFSNYELYRRRYPKS 349
            ..:  .|.........|...| |:.:.:.             |:|||    .|..:: |..|...
Zfish   246 HFMYPESAKNLAANVSFVLVP-FKTLDLL-------------WITSA----LSTGQI-RFTYAPV 291

  Fly   350 RAFL-IDPHSVWRLWQSLQMFAGNRPISKNP-----------------PSSGFIGLALLLPHCPQ 396
            :.|| :|...|       |:|        ||                 ||:|.:.|...|..|.:
Zfish   292 KQFLRVDKDKV-------QIF--------NPAFFKYIHDRWTRHHGRYPSTGMLVLFFALHVCDE 341

  Fly   397 VDFVEYVPSTRLNGRCHYY 415
            |:...:...:|  |..|:|
Zfish   342 VNVFGFGADSR--GNWHHY 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 56/212 (26%)
st3gal2XP_009291823.1 Glyco_transf_29 143..395 CDD:279159 62/260 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.