DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St6galnac6

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_038961569.1 Gene:St6galnac6 / 407765 RGDID:1303196 Length:333 Species:Rattus norvegicus


Alignment Length:333 Identity:82/333 - (24%)
Similarity:120/333 - (36%) Gaps:90/333 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 KHSELCHNKTQQFRQRIVRAFEKAMVESVNESQAN---HYN---------VDYKPVFGDSFEEQY 195
            :..|:..||.|:....:|......::...:.:.||   ||.         |:.|..   ||...|
  Rat    31 RRREMSSNKEQRSAVFVVLFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKW---SFSNAY 92

  Fly   196 YPSTCLVMEAGVRVLRRKDAPFNKLPFGRLFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFID 260
            :|           :|..|..|                   .....|.||:|:..|.|:|||..|:
  Rat    93 FP-----------ILGNKTLP-------------------SRCNQCVIVTSSSHLLGTKLGPEIE 127

  Fly   261 THDIVMRFNHAPTQGHEVDVGSKTTIRVVNS----QVVTKPEFDFTRAPIFRNVTIAAWDP---- 317
            ..:..:|.|.|||.|:..|||:|||.|||..    :|:.||:....|.|   ......|.|    
  Rat   128 RAECTIRMNDAPTTGYSADVGNKTTFRVVAHSSVFRVLRKPQEFVNRTP---ETVFIFWGPPNKM 189

  Fly   318 GKYNGTLEDWLTSADYDLFSNYELYRRRYPKSRAFLIDPHSVWRLWQSLQMFAG----NRPISKN 378
            .|..|:|...:..|.. .|.|.|    .|..|:|         |:.|...:|.|    :|..|.:
  Rat   190 QKPQGSLLRVIQRAGL-AFPNME----AYAVSQA---------RMQQFDDLFRGETGKDREKSHS 240

  Fly   379 PPSSGFIGLALLLPHCPQVDFVEYVPSTRLNGR-------CHYYSKEMNSAC-TF--------GS 427
            ..|:|:..:.:.:..|..|.....||....:.|       .|||..:....| |:        |:
  Rat   241 WLSTGWFTMVIAVELCDHVHVYGMVPPDYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGN 305

  Fly   428 WHPLAAEK 435
            .|....||
  Rat   306 HHRFITEK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 64/240 (27%)
St6galnac6XP_038961569.1 Glyco_transf_29 102..287 CDD:395627 59/220 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.