DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st3gal6

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_989427.2 Gene:st3gal6 / 402790 XenbaseID:XB-GENE-947392 Length:331 Species:Xenopus tropicalis


Alignment Length:363 Identity:86/363 - (23%)
Similarity:143/363 - (39%) Gaps:112/363 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NEKFIVESRENPAINSSKLAPHPRLKVSKNTKLTLSPKLYLCHDKHSELCHNKTQQFRQRIVRAF 163
            ||||.:      .:|:|::.|                  :||.|            ||:      
 Frog    51 NEKFRL------ILNTSEIEP------------------FLCQD------------FRK------ 73

  Fly   164 EKAMVESVNESQANHYNVDYKPVFGDSFEEQYYPSTCLVMEAGVRVLRRKDAPFNKLPFGRLFPR 228
                 :|||.. :|..::.|....|:.|.:                |..|:.|...||       
 Frog    74 -----QSVNLG-SNKLDLPYGIRRGERFFD----------------LALKNLPQCTLP------- 109

  Fly   229 QKLFRNVKDI--KTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNS 291
                ..:|:|  |.|.:|.:.|.|..|.||:.||::||::|.|..|..|:|.|||.|||.|    
 Frog   110 ----EEIKNISCKKCVVVGNGGVLRNSTLGKKIDSYDIIIRMNDGPVLGYEDDVGRKTTFR---- 166

  Fly   292 QVVTKPEFDFTRAPIFRNVTIAAWDPGKYNGTL---------EDWLTS-ADYDLFSNYELYRRR- 345
              :..||..|:.:        ..:||   |.|:         ..||:. ..:...|.|..:|:. 
 Frog   167 --LCYPESIFSNS--------LHYDP---NSTVVLLMFKPHDVKWLSELLMHKRVSTYGFWRKPA 218

  Fly   346 ----YPKSRAFLIDPHSVWRLWQSLQMFAGNRPISKNP--PSSGFIGLALLLPHCPQVDFVEYVP 404
                |...:..:::|..:.::.|::..|..:.|.::.|  |::|.|.:.|....|.:|....:..
 Frog   219 MNLIYKPHQLRVLNPFILRQVSQNILNFPLSFPKTEKPKHPTTGIIAITLAFHICNEVHIAGFKY 283

  Fly   405 S-TRLNGRCHYYSKEMNSACTFGSWHPLAAEKLMALDM 441
            : |.||...|||..|..|......:|.::||::...|:
 Frog   284 NLTSLNSSLHYYGNETMSVMAQNEYHNISAEQMFIRDL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 61/232 (26%)
st3gal6NP_989427.2 Glyco_transf_29 73..331 CDD:395627 74/305 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.