DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st3gal3

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001016104.2 Gene:st3gal3 / 402789 XenbaseID:XB-GENE-941048 Length:415 Species:Xenopus tropicalis


Alignment Length:372 Identity:86/372 - (23%)
Similarity:142/372 - (38%) Gaps:106/372 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 INSSKLAPHPR-LKVSK-NTKLTLSPKLYLCHDKHSELCHNKTQQFRQRIVR-AFEKAMVESVNE 173
            :|..::||.|. ||..: ...|.|..||.:      ||. .:...|.:.:.: .:..|::.::  
 Frog    83 LNEPRVAPVPSILKYDRLGFLLKLETKLPV------ELA-TRYANFSEGVCKPGYASALMNAI-- 138

  Fly   174 SQANHYNVDYKPV---FGDSFEE-----QYYPSTCLVMEAGVRVLRRKDAPFNKLPFG------- 223
                 |....||.   ..|||.:     :|.|                       |||       
 Frog   139 -----YPKFSKPAPMFLDDSFRKWAKIREYVP-----------------------PFGIKGQDNL 175

  Fly   224 --RLFPRQKLFR-----NVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVG 281
              .:....|.:|     :..:.:.|.||.:.|.||...||..||.:::|:|.|.||.:|.|.|||
 Frog   176 IKAILSATKEYRLKPALDSLNCRRCIIVGNGGVLANKSLGSKIDEYEVVVRLNSAPVKGFEKDVG 240

  Fly   282 SKTTIRVVNSQVVTKPEFDFTRAPIFRNVTIAA--WDPGKYNGTLEDWLTSADYDLFSNYELYRR 344
            ||||:|:...:...:....:.:..||   .:|.  |...|       ||         .|.:|:.
 Frog   241 SKTTLRITYPEGAIQKLEQYEKDSIF---VLAGFKWQDFK-------WL---------KYIVYKE 286

  Fly   345 R------YPKSRAFLI--DPHSV-----WRLWQSLQMFAGNRPISK------NPPSSGFIGLALL 390
            :      :.||.|..:  :||.:     :.:.::...|.| .|.:.      |.|:.|.:.:.:.
 Frog   287 KVSAADGFWKSVATRVPREPHEIRILNPYFIQEAAFSFIG-LPFNNGLMGRGNIPTLGSVAITMA 350

  Fly   391 LPHCPQVDFVEYVPSTRL-NGRCHYYSKEMNSACTFGSW-HPLAAEK 435
            |.:|.:|....:.....| |...||| :.:..|....|| |.:..||
 Frog   351 LHNCDEVAVAGFGYDMNLPNAPLHYY-ETIKMAAIKESWTHNIQKEK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 61/240 (25%)
st3gal3NP_001016104.2 Glyco_transf_29 147..412 CDD:366297 69/294 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.