DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st3gal5

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_955810.2 Gene:st3gal5 / 394230 ZFINID:ZDB-GENE-060322-1 Length:364 Species:Danio rerio


Alignment Length:241 Identity:56/241 - (23%)
Similarity:90/241 - (37%) Gaps:73/241 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PFGRLFPRQKL--FRNV-----------KDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAP 272
            |||.|..:.||  ..|:           :|.:.|.:|.:.|.|.|..||..::..||::|.|..|
Zfish   107 PFGFLDMKNKLEEILNLLPVSSEQRLGERDCRRCVVVGNGGILKGLGLGHLLNRFDIIIRLNSGP 171

  Fly   273 TQGHEVDVGSKTTIRVVNSQVV------TKPEFDFTRAPIFRNV------------TIAAWDPGK 319
            .|....|||::||||:...:..      |.|:..:. |.||::|            .::.||   
Zfish   172 LQDFSADVGNRTTIRMSYPESCPKVWEDTDPDLKYV-AVIFKSVDFHWLRAMISRTPVSLWD--- 232

  Fly   320 YNGTLEDW--------LTSADYDLFSNYELYRR------RYPKSRAFLIDPHSVWRLWQSLQMFA 370
               .|..|        :.::.:.|. |.::.|.      .||:.:.         |||.      
Zfish   233 ---RLFFWQNVPMSVPVKTSQFHLL-NPQIIREMALDLLNYPEPKK---------RLWS------ 278

  Fly   371 GNRPISKNPPSSGFIGLALLLPHCPQVDFVEY-VPSTRLNGRCHYY 415
                ..:|.|:.|...|.|....|.:|....: ...::.....|||
Zfish   279 ----WDQNIPTLGLTALNLATYICDEVSLAGFGYNLSQKEAPLHYY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 53/238 (22%)
st3gal5NP_955810.2 Glyco_transf_29 88..356 CDD:279159 56/241 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.