DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and st3gal3a

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_021332477.1 Gene:st3gal3a / 393326 ZFINID:ZDB-GENE-040426-1322 Length:401 Species:Danio rerio


Alignment Length:247 Identity:62/247 - (25%)
Similarity:91/247 - (36%) Gaps:72/247 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 KTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKPEFDFTR 303
            |.|.|:.:.|.|....||..||.:|:|:|.|.||..|.|.|||||||:|      :|.||....|
Zfish   158 KKCIIIGNGGILFNKSLGTKIDQYDVVVRLNEAPVAGFEKDVGSKTTMR------ITYPEGAIQR 216

  Fly   304 APIFRNVTIAAWDPGKYNGTLEDWLTSADYDLFSNYELYRRRYPKSRAFLID------------P 356
            |..:...::......|.|..  .||         .:.:|:.|........::            .
Zfish   217 AERYEKSSLFVLSAFKSNDF--KWL---------RHMVYKDRLTPGGPLTVNQIQTDAFETCGPE 270

  Fly   357 HSV-WRL---WQSLQMFAGNRPISK---NP-------------------------PSSGFIGLAL 389
            :|: ||:   |:|:.......|...   ||                         |:.|.:.:.:
Zfish   271 YSLSWRMDGFWKSVARVVPRAPQDMRILNPYFIQEASFRLIGLPHNNGLMGRGNIPTLGTVAITM 335

  Fly   390 LLPHCPQVDFVEY-----VPSTRLNGRCHYYSKEMNSACTFGSW-HPLAAEK 435
            .|.:|.:|....:     .|...|    |||.|...||.. .|| |.::.||
Zfish   336 ALHNCDEVAVAGFGYDMNTPHAPL----HYYEKLRMSAIK-ESWTHNISREK 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 62/247 (25%)
st3gal3aXP_021332477.1 Glyco_transf_29 107..398 CDD:307084 62/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.