DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St6galnac5

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001258290.1 Gene:St6galnac5 / 365984 RGDID:1564252 Length:339 Species:Rattus norvegicus


Alignment Length:269 Identity:70/269 - (26%)
Similarity:112/269 - (41%) Gaps:48/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 PFNKLPFGRLFPRQ-KLFRNVKD-------IKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAP 272
            |....|.|   ||| ..:..|.|       .|.||:|:|:|.|..|:.|..||..:.|:|.|.||
  Rat    69 PHRTAPVG---PRQLDGYLGVADHKPLKMHCKDCALVTSSGHLLRSQQGPHIDQTECVIRMNDAP 130

  Fly   273 TQGHEVDVGSKTTIRVV---NSQVVTKPEFDFTRAPIFRNVTIAAWDPGKYNGTLEDWLTSADYD 334
            |:|:.:|||::|::||:   :.|.:.:...|...  :.:......|.|..|      ........
  Rat   131 TRGYGLDVGNRTSLRVIAHSSIQRILRNRHDLLN--VSQGTVFIFWGPSSY------MRRDGKGQ 187

  Fly   335 LFSNYELYRRRYPKSRAFLIDPHSVWRLWQSLQMFAG-NRPISKNPPSSGFIGLALLLPHCPQVD 398
            :::|.:|..:..|:.:||:|..|.:.:..:..:...| :|.||....|:|:..:.:.|..|.::|
  Rat   188 VYNNLQLLSQVLPRLKAFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRID 252

  Fly   399 FVEYVPSTRLNGRC----------HYYSKEMNSACTF---------GSWHPLAAEKLMALDMNMA 444
            ....||.    ..|          |||.......||.         ||.|....||  .:..|.|
  Rat   253 VYGMVPP----DFCRDPKHPSVPYHYYEPSGPDECTMYLSHERGRKGSHHRFITEK--RVFKNWA 311

  Fly   445 EDDDMSVFQ 453
            ...::..||
  Rat   312 RTFNIHFFQ 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 63/243 (26%)
St6galnac5NP_001258290.1 Glyco_transf_29 91..312 CDD:279159 59/234 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.