DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and ST8SIA6

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001004470.1 Gene:ST8SIA6 / 338596 HGNCID:23317 Length:398 Species:Homo sapiens


Alignment Length:431 Identity:89/431 - (20%)
Similarity:143/431 - (33%) Gaps:129/431 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 WNPNEK------FIVESRE----NPAINSSKLAPHPRLKVSKNTKLTLSPKLYLCHDKHSELCHN 150
            |.|.:.      .:.||||    .||...:..:|...:..:.|:.......|.|     :|.|  
Human    24 WCPADAPGRARILVEESREATHGTPAALRTLRSPATAVPRATNSTYLNEKSLQL-----TEKC-- 81

  Fly   151 KTQQFRQRIVRAFEKAMVESVNESQANHYNVDYKPVFGD-------SFEEQY------YPSTCLV 202
            |..|:.           :||.:.....:...||..:..|       ...|:|      ..|.|..
Human    82 KNLQYG-----------IESFSNKTKGYSENDYLQIITDIQSCPWKRQAEEYANFRAKLASCCDA 135

  Fly   203 MEAGV--------------RVLRRKDAPFNKLPFGRLFPRQKLFRNVKDIKTCAIVSSAGSLAGS 253
            ::..|              .|..:|:.|..|..| .:||..:.|.:. ....||:|.:.|.|..|
Human   136 VQNFVVSQNNTPVGTNMSYEVESKKEIPIKKNIF-HMFPVSQPFVDY-PYNQCAVVGNGGILNKS 198

  Fly   254 KLGRFIDTHDIVMRFNHAPTQGH-EVDVGSKTTIRVVNSQVVTKPEFDFTRAPIFRNVTIAAWDP 317
            ..|..||..|.|.|.|..||.|. ..||||||.:..:|..::|.                     
Human   199 LCGTEIDKSDFVFRCNLPPTTGDVSKDVGSKTNLVTINPSIITL--------------------- 242

  Fly   318 GKYNGT-------LEDWLTSAD-YDLFSNYEL-----------YRRRYPKSRAFLIDPHSVWRLW 363
             ||...       |||..|..| :.|...:..           |.....|:|..::..|.  :..
Human   243 -KYGNLKEKKALFLEDIATYGDAFFLLPAFSFRANTGTSFKVYYTLEESKARQKVLFFHP--KYL 304

  Fly   364 QSLQMFAGNRPISKNPPSSGFIGLALLLPHCPQVDF---------VEYVPSTRLNGRCHYYSKEM 419
            :.|.:|...:.::....|:|.:..::.:..|..|..         ||.:|.:.     |||..::
Human   305 KDLALFWRTKGVTAYRLSTGLMITSVAVELCKNVKLYGFWPFSKTVEDIPVSH-----HYYDNKL 364

  Fly   420 NSACTFGSWHPLAAEKLMALDMNMAEDDDMSVFQFGILRIR 460
            ..    ..:|.:..|....|.::|.          |||:::
Human   365 PK----HGFHQMPKEYSQILQLHMK----------GILKLQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 53/241 (22%)
ST8SIA6NP_001004470.1 Glyco_transf_29 138..391 CDD:395627 64/297 (22%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O43173 236..238 1/1 (100%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O43173 322..324 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.