DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and 6430550D23Rik

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001138823.1 Gene:6430550D23Rik / 320095 MGIID:2443361 Length:194 Species:Mus musculus


Alignment Length:158 Identity:30/158 - (18%)
Similarity:48/158 - (30%) Gaps:63/158 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 SPKLYLCHDKHSELCHNKTQQFRQRIVRAFEKAM----VESVNESQANHYNVDYKPVFGDSFEEQ 194
            ||....||....|.|:.|...:.:      .||:    :.||:|    |..|..||         
Mouse    55 SPNCSTCHHTAGEACYEKFMGYWR------TKALWWLGMNSVSE----HGTVWKKP--------- 100

  Fly   195 YYPSTCLVMEAGVRVLRRKDAPFNKLPFGRLFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFI 259
                      :||.                  |...|........:||::.::|         |.
Mouse   101 ----------SGVT------------------PNSLLHHFDFHCVSCAMLGNSG---------FS 128

  Fly   260 DTHDI---VMRFNHAPTQGHEVDVGSKT 284
            :.:.:   ..|.|.|.....|.::.|:|
Mouse   129 NINQLFYMAFRTNQASNHSSEAEMRSQT 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 12/64 (19%)
6430550D23RikNP_001138823.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.