DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and ST6GALNAC6

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001273928.1 Gene:ST6GALNAC6 / 30815 HGNCID:23364 Length:374 Species:Homo sapiens


Alignment Length:195 Identity:58/195 - (29%)
Similarity:85/195 - (43%) Gaps:36/195 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 CAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNS----QVVTKPEFDF 301
            |.||||:..|.|:|||..|:..:..:|.|.|||.|:..|||:|||.|||..    :|:.:|:...
Human   108 CVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFV 172

  Fly   302 TRAPIFRNVTIAAWDP----GKYNGTLEDWLTSADYDLFSNYELYRRRYPKSRAFLIDPHSVWRL 362
            .|.|   ......|.|    .|..|:|...:..|.. :|.|.|          |:.:.|   .|:
Human   173 NRTP---ETVFIFWGPPSKMQKPQGSLVRVIQRAGL-VFPNME----------AYAVSP---GRM 220

  Fly   363 WQSLQMFAG----NRPISKNPPSSGFIGLALLLPHCPQVDFVEYVPSTRLNGRCHYYSKEMNSAC 423
            .|...:|.|    :|..|.:..|:|:..:.:.:..|..|.....||.       :|.|...:|||
Human   221 RQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPP-------NYCSGPASSAC 278

  Fly   424  423
            Human   279  278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 58/195 (30%)
ST6GALNAC6NP_001273928.1 Glyco_transf_29 102..266 CDD:279159 51/174 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.