DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and ST8SIA5

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001294915.1 Gene:ST8SIA5 / 29906 HGNCID:17827 Length:412 Species:Homo sapiens


Alignment Length:363 Identity:78/363 - (21%)
Similarity:135/363 - (37%) Gaps:101/363 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 HNKTQ--QFRQRIVRAFEKAMVE----------------SVNESQANHYNVDYK-----PVFGDS 190
            :|.|:  :.|..|:.....:||:                ::|.|:||.:.....     |.|..:
Human    91 YNSTRCLELRHEILEVKVLSMVKQSELFDRWKSLQMCKWAMNISEANQFKSTLSRCCNAPAFLFT 155

  Fly   191 FEE--------QYYPSTCLVMEAGVRVLRR--KDAPFNKLPFGRLFPRQKLFRNVKDIKTCAIVS 245
            .::        :|...|..:......:.|.  ||.|:.:..|                |.||:|.
Human   156 TQKNTPLGTKLKYEVDTSGIYHINQEIFRMFPKDMPYYRSQF----------------KKCAVVG 204

  Fly   246 SAGSLAGSKLGRFIDTHDIVMRFNHAP-TQGHEVDVGSKTTIRVVNSQVVTK--PEFDFTRAPIF 307
            :.|.|..|:.||.|::.|.|.|.|..| ::.:.:|||.||.:..||..::|:  .:.:..|.|.:
Human   205 NGGILKNSRCGREINSADFVFRCNLPPISEKYTMDVGVKTDVVTVNPSIITERFHKLEKWRRPFY 269

  Fly   308 R------NVTIAAWDPGKYNGTLEDWLTSADYDLFSNYELYRRRYPKSRAFLIDPHSVWRLWQSL 366
            |      |.::..  |..||....|......| :..::|..:..|.....:|:   :|.|.|.||
Human   270 RVLQVYENASVLL--PAFYNTRNTDVSIRVKY-VLDDFESPQAVYYFHPQYLV---NVSRYWLSL 328

  Fly   367 QMFAGNRPISKNPPSSGFIGLALLLPHCPQVDFVEY----VPSTRLNGRCHYYSKEMNSACTFGS 427
            .:.|       ...|:|.|.:...|..|.:|....:    :..:.|....|||    ::......
Human   329 GVRA-------KRISTGLILVTAALELCEEVHLFGFWAFPMNPSGLYITHHYY----DNVKPRPG 382

  Fly   428 WHPLAAEKLMALDMNMAEDDDMSVFQF------GILRI 459
            :|.:.:|                :|.|      ||||:
Human   383 FHAMPSE----------------IFNFLHLHSRGILRV 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 53/225 (24%)
ST8SIA5NP_001294915.1 Glyco_transf_29 153..406 CDD:279159 66/301 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.