DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St6galnac3

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_061996.2 Gene:St6galnac3 / 29758 RGDID:3677 Length:305 Species:Rattus norvegicus


Alignment Length:112 Identity:36/112 - (32%)
Similarity:58/112 - (51%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 CAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQ----VVTKPEFDF 301
            ||:||::|.:.|.|:|..||....:.|.|:|||:|.|.|||..|.:|||:..    ::..|::.|
  Rat    80 CAVVSNSGQMVGQKVGEEIDRASCIWRMNNAPTKGFEEDVGYMTMVRVVSHTSVPLLLKNPDYFF 144

  Fly   302 TRAPIFRNVTI-AAWDPGKY-----NGTLEDWLTSADYDLFSNYELY 342
            ..|    :.|| ..|.|.:.     ||.:.:.|... .|.:.:.::|
  Rat   145 KEA----STTIYVIWGPFRNMRKDGNGIVYNMLKKT-VDTYPDAQIY 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 36/112 (32%)
St6galnac3NP_061996.2 Glyco_transf_29 77..297 CDD:395627 36/112 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.