DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St6galnac1

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001099329.1 Gene:St6galnac1 / 287920 RGDID:1562048 Length:520 Species:Rattus norvegicus


Alignment Length:563 Identity:114/563 - (20%)
Similarity:190/563 - (33%) Gaps:204/563 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SSGQSQALLSCLIIAVCAALIIQ---------------SGHIQGVKAQPGREPGEVNSRQPGNGA 57
            |.||:..||:.|::......:::               ...:|||..:|..: |.:.:..|   .
  Rat     9 SQGQTFLLLTGLMLLFILPSVVKEPSTRVSRYQFIEDNESSLQGVPQKPAPQ-GPIVTLTP---T 69

  Fly    58 YENSTGTERRLRKVIWKCI-----PTGNGTTGHRVPRSVFHVRWNPNEKFIVESRENPAINSSKL 117
            ..|...|..|.:   |..:     .|..|..|..|.:.:..:|..|         |||     |.
  Rat    70 VHNKKTTSVRTK---WVELQKQDRATARGERGEGVEKKLQAIRLAP---------ENP-----KG 117

  Fly   118 APHPRLKVSKNTKLTLSPKLYLCHDKHSELCHNKTQQ------FRQRIVR------AFEKAMVES 170
            ...|.:|...:..|...|:      ....|...|||.      .::::|:      :|.....:.
  Rat   118 KAEPEVKTPASKHLDKLPR------ATGALSTRKTQMATGAAPAKKKVVQPTPTPASFPHLTTQR 176

  Fly   171 VNESQANHYNVDYKPVFGDSFEEQY-----------------------------YPSTCLVMEAG 206
            ....:|:    |:|......|||:|                             .|:..|.:::|
  Rat   177 RQRLKAS----DFKSEPRWDFEEEYSLDGGSLQTTCPGSVKITASHSPWLQNIFLPNITLFLDSG 237

  Fly   207 VRVLRRKDAPFNKL-----PFGRL----------------FPRQKLF------RNVKDIKTCAIV 244
                |...:.:.:|     |||.:                .|:|:|.      ||:..| |||:|
  Rat   238 ----RFNQSEWYRLEHFTPPFGFMELNQSLVQKVVSRFPPVPQQQLLLASLPTRNLTCI-TCAVV 297

  Fly   245 SSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTT------IRVVNSQVVTKPEFDFTR 303
            .:.|.|..|::|:.||:||.|.|.:.|..:|:|.|||::|:      ..:|.| ::......|..
  Rat   298 GNGGILNNSRMGQEIDSHDYVFRLSGAVIKGYEQDVGTRTSFYGFTAFSLVQS-ILNLGRQGFQH 361

  Fly   304 APIFRNVTIAAWDPGKYNGTLE-----DWL-------TSADYDLF----SNYELYRRRYPKSRAF 352
            .|:.::|        :|...||     :||       |.|:..|:    ...|.:|......|.|
  Rat   362 VPLGKDV--------RYLHFLEGTRDYEWLEAMFLNRTMANTKLYWFRHRPQEAFREALDLDRYF 418

  Fly   353 LIDPHSV-----------------WRLWQSLQMFAGNRPISKNPPSSGFIGLALLLPHCPQVDFV 400
            |:.|..:                 |||::               |::|.:.|...|..|.:|...
  Rat   419 LVHPDFLRYMKNRFLRSKTLDTAHWRLYR---------------PTTGALLLLTALHLCDKVSAY 468

  Fly   401 EYVPSTRLNGRCHYYSKEMNSACTFGSW--------HPLAAEK 435
            .::.........|||..         ||        |..|.|:
  Rat   469 GFITQGHERFSDHYYDT---------SWKRLIFYINHDFALER 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 63/281 (22%)
St6galnac1NP_001099329.1 Glyco_transf_29 232..518 CDD:279159 70/309 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.