DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St6galnac5

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_036158.3 Gene:St6galnac5 / 26938 MGIID:1349471 Length:335 Species:Mus musculus


Alignment Length:296 Identity:75/296 - (25%)
Similarity:121/296 - (40%) Gaps:54/296 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 EEQYYPSTCLVMEAGVRVLRRKDAPFNKLPFGRLFPRQ-KLFRNVKD-------IKTCAIVSSAG 248
            ::|.............:::.....|....|.|   ||| :.:..|.|       .|.||:|:|:|
Mouse    41 QQQQQQQQAATATGSTQLVESSPQPRRTAPAG---PRQLEGYLGVADHKPLKMHCKDCALVTSSG 102

  Fly   249 SLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVV---NSQVVTKPEFDFTRAPIFRNV 310
            .|..|:.|..||..:.|:|.|.|||:|:.:|||::|::||:   :.|.:.:...|...  :.:..
Mouse   103 HLLRSQQGPHIDQTECVIRMNDAPTRGYGLDVGNRTSLRVIAHSSIQRILRNRHDLLN--VSQGT 165

  Fly   311 TIAAWDPGKYNGTLEDWLTSADYDLFSNYELYRRRYPKSRAFLIDPHSVWRLWQSLQMF----AG 371
            ....|.|..|  ...|....|    ::|.:|..:..|:.:||:|..|   |:.|..::|    ..
Mouse   166 VFIFWGPSSY--MRRDGKGQA----YNNLQLLSQVLPRLKAFMITRH---RMLQFDELFKQETGK 221

  Fly   372 NRPISKNPPSSGFIGLALLLPHCPQVDFVEYVPSTRLNGRC----------HYYSKEMNSACTF- 425
            :|.||....|:|:..:.:.|..|.::|....||.    ..|          |||.......||. 
Mouse   222 DRKISNTWLSTGWFTMTIALELCDRIDVYGMVPP----DFCRDPKHPSVPYHYYEPSGPDECTMY 282

  Fly   426 --------GSWHPLAAEKLMALDMNMAEDDDMSVFQ 453
                    ||.|....||  .:..|.|...::..||
Mouse   283 LSHERGRKGSHHRFITEK--RVFKNWARTFNIHFFQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 67/246 (27%)
St6galnac5NP_036158.3 Glyco_transf_29 87..308 CDD:279159 63/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.