DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St8sia3

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_037161.2 Gene:St8sia3 / 25547 RGDID:3680 Length:380 Species:Rattus norvegicus


Alignment Length:367 Identity:80/367 - (21%)
Similarity:123/367 - (33%) Gaps:122/367 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 SPKLYLCH----------------------------DKHSELCHNKTQQFRQR--------IVRA 162
            :|::|:.|                            :|.|:...|:|....||        :::.
  Rat    49 APRMYMFHAGFRSQFALKFLDPSFVPITNSLTHELQEKPSKWTFNRTAFLHQRQEILQHVDVIKN 113

  Fly   163 FEKAMVESVNESQANHYNV-DYKPVFGDSFEEQYYPSTCLVMEAGVRVLRRKDAPFNKLPFGRLF 226
            |.... .||...|..||:. .:|.||..|..                             |..|.
  Rat   114 FSLTK-NSVRIGQLIHYDYSSHKYVFSISNN-----------------------------FRSLL 148

  Fly   227 PRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNS 291
            |......| |....||:|.::|.|.||:.|:.||..|.|.|.|.|||:....|||.||.:...|.
  Rat   149 PDVSPILN-KRYNICAVVGNSGILTGSQCGQEIDKSDFVFRCNFAPTEAFHKDVGKKTNLTTFNP 212

  Fly   292 QVVTKPEFDFTRAPIFRNVTIAAWDPGKYNGTLED------WL------TSAD-----YDLFSNY 339
            .::.|          :.|..:...|...:..:|:.      |:      |||.     .|.|..:
  Rat   213 SILEK----------YYNNLLTIQDRNNFFLSLKKLDGAILWIPAFFFHTSATVTRTLVDFFVEH 267

  Fly   340 ELYRRRYPKSRAFLIDPHSVW----RLWQSLQMFAGNRPISKNPPSSGFIGLALLLPHCPQVDF- 399
            .      .:.:..|..|.::.    |.|:       |:.:|....|:|.:...|....|.::.. 
  Rat   268 R------GQLKVQLAWPGNIMQHVNRYWK-------NKHLSPKRLSTGILMYTLASAICEEIHLY 319

  Fly   400 ----VEYVPSTRLNGRCHYYSKEMNSACTFGSW---HPLAAE 434
                ..:.|:||.:...|||.|:.....|  .|   |.|.||
  Rat   320 GFWPFGFDPNTREDLPYHYYDKKGTKFTT--KWQESHQLPAE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 60/240 (25%)
St8sia3NP_037161.2 Glyco_transf_29 113..376 CDD:395627 71/303 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.