DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St8sia1

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_036945.2 Gene:St8sia1 / 25280 RGDID:3679 Length:356 Species:Rattus norvegicus


Alignment Length:390 Identity:85/390 - (21%)
Similarity:132/390 - (33%) Gaps:127/390 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VFHVRWNPNEKFIVESRENPAINSSKLAPHPRLKVSKNTKLTLSPKLYLCHDKHSELCHNKTQQF 155
            ||.|...||||.||:         ..||.....:.::.     |.:|:   .|..|.|.|....|
  Rat    44 VFPVYRLPNEKEIVQ---------GVLAQRTAWRRNQT-----SARLF---RKQMEDCCNPAHLF 91

  Fly   156 RQRIVRAFEKAMVESVNESQANHYNVDYKPVFGDSFEEQYYPSTCLVMEAGVRVLRRKDAPFNKL 220
                      ||.: ||.........|.:.::..:.:...|                        
  Rat    92 ----------AMTK-VNSPMGKSLWYDGEFLYSLTIDNSTY------------------------ 121

  Fly   221 PFGRLFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAP-TQGHEVDVGSKT 284
               .|||:...|:  ..:|.||:|.:.|.|..|..||.||..:.|||.|..| :..:..||||||
  Rat   122 ---SLFPQATPFQ--LPLKKCAVVGNGGILKMSGCGRQIDEANFVMRCNLPPLSSEYTRDVGSKT 181

  Fly   285 TIRVVNSQVVTKPEFDFTRAPIFRNVTIAAWDPGKYNGTLEDWLTSADYDLFSNYELYRRRYPKS 349
            .:...|..::.:.         |.|:   .|...|:               ..|.::|...|...
  Rat   182 QLVTANPSIIRQR---------FENL---LWSRKKF---------------VDNMKIYNHSYIYM 219

  Fly   350 RAFLI----DPHSVWRLWQSLQ--------MFAG------------NRPISKNPPSSGFIGLALL 390
            .||.:    :|.  .|::.:|:        :||.            .|.|.....|:|...::..
  Rat   220 PAFSMKTGTEPS--LRVYYTLKDAGANQTVLFANPNFLRNIGKFWKGRGIHAKRLSTGLFLVSAA 282

  Fly   391 LPHCPQVDFVEYVP-STRLNGR---CHYYSKEMNSACTFGSWHPLAAE--------KLMALDMNM 443
            |..|.:|....:.| |..:.|.   .|||    ::...|..:|.:..|        |:.||.|.:
  Rat   283 LGLCEEVSIYGFWPFSVNMQGEPISHHYY----DNVLPFSGFHAMPEEFLQLWYLHKMGALRMQL 343

  Fly   444  443
              Rat   344  343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 58/249 (23%)
St8sia1NP_036945.2 Glyco_transf_29 91..343 CDD:279159 68/324 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.