DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St8sia1

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_035504.2 Gene:St8sia1 / 20449 MGIID:106011 Length:355 Species:Mus musculus


Alignment Length:256 Identity:64/256 - (25%)
Similarity:98/256 - (38%) Gaps:72/256 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAP-TQGHEVDVGSKTTIRV 288
            |||:...|:  ..:|.||:|.:.|.|..|..||.||..:.|||.|..| :..:..||||||.:..
Mouse   123 LFPQATPFQ--LPLKKCAVVGNGGILKMSGCGRQIDEANFVMRCNLPPLSSEYTRDVGSKTQLVT 185

  Fly   289 VNSQVVTKPEFD---FTRAPIFRNVTIAAWDPGKYN-------------GT---LEDWLTSADYD 334
            .|..:: :..|:   ::|.....|:.|       ||             ||   |..:.|..|..
Mouse   186 ANPSII-RQRFENLLWSRKKFVDNMKI-------YNHSYIYMPAFSMKTGTEPSLRVYYTLKDVG 242

  Fly   335 -----LFSNYELYRRRYPKSRAFLIDPHSVWRLWQSLQMFAGNRPISKNPPSSGFIGLALLLPHC 394
                 ||:|....|              ::.:.|:|       |.|.....|:|...::..|..|
Mouse   243 ANQTVLFANPNFLR--------------NIGKFWKS-------RGIHAKRLSTGLFLVSAALGLC 286

  Fly   395 PQVDFVEYVP-STRLNG---RCHYYSKEMNSACTFGSWHPLAAE--------KLMALDMNM 443
            .:|....:.| |..:.|   ..|||    ::...|..:|.:..|        |:.||.|.:
Mouse   287 EEVSIYGFWPFSVNMQGDPISHHYY----DNVLPFSGYHAMPEEFLQLWYLHKIGALRMQL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 61/248 (25%)
St8sia1NP_035504.2 Glyco_transf_29 91..343 CDD:279159 64/254 (25%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O43173 187..189 1/1 (100%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:O43173 273..275 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2692
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.