DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SiaT and St6galnac3

DIOPT Version :9

Sequence 1:NP_523853.1 Gene:SiaT / 37950 FlyBaseID:FBgn0035050 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_006501282.1 Gene:St6galnac3 / 20447 MGIID:1341828 Length:315 Species:Mus musculus


Alignment Length:199 Identity:56/199 - (28%)
Similarity:84/199 - (42%) Gaps:59/199 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 KPVFGDSFEEQYYPSTCLVMEAGVRVLRRKDAPFNKL------PFGRLFPRQKLFR--------- 233
            |||...||     .:.|:::.| :|::  .||.|..|      |..:..|....||         
Mouse    18 KPVLVVSF-----IALCILLLA-MRLV--NDATFPLLLNCFGQPKTKWIPLPYTFRQPLRTHYGY 74

  Fly   234 -NVK-------DIKTCAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVN 290
             ||:       :...|||||::|.:.|.|:|..||....:.|.|:|||:|.|.|||..|.:|||:
Mouse    75 INVRTQEPLQLNCNHCAIVSNSGQMVGQKVGEEIDHASCIWRMNNAPTKGFEEDVGYMTMVRVVS 139

  Fly   291 SQ----VVTKPEFDFTRA---------PIFRNV--------------TIAAWDPGKYNGTLEDWL 328
            ..    ::..|::.|..|         | |||:              |:.|:...:...|.|..:
Mouse   140 HTSVPLLLKNPDYFFKEASRTIYVIWGP-FRNMRKDGNGIVYNMLKKTVDAYPDAQIYVTTEQQM 203

  Fly   329 TSAD 332
            |..|
Mouse   204 THCD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SiaTNP_523853.1 Glyco_transf_29 224..437 CDD:279159 43/153 (28%)
St6galnac3XP_006501282.1 Glyco_transf_29 87..307 CDD:366297 38/122 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.